BDGP Sequence Production Resources |
Search the DGRC for AT11516
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 115 |
Well: | 16 |
Vector: | pOTB7 |
Associated Gene/Transcript | RpL10Aa-RA |
Protein status: | AT11516.pep: gold |
Preliminary Size: | 651 |
Sequenced Size: | 799 |
Gene | Date | Evidence |
---|---|---|
CG3843 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3843 | 2002-04-26 | Blastp of sequenced clone |
CG3843 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL10Aa | 2008-04-29 | Release 5.5 accounting |
RpL10Aa | 2008-08-15 | Release 5.9 accounting |
RpL10Aa | 2008-12-18 | 5.12 accounting |
799 bp (799 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113239
> AT11516.complete ATTTTGTGCTTGTAGAATTGTTTAAATATTTTTGTTGCTCACAGCTGATC ATAAATTATGGTGTCGAAAGTTTCTCGCGATACGATTTACGTTGCAGTCA AAAATATCCTGCTGAACTCGCAGGCCAAAGGACCAGACTGCCTGGAGACG GTGGAGCTGCAGATTGGGCTGAGGGATTATGATCCTGACAAATGCAAGCG GTTCCATGGAAGTGTACTATTGCATCACCTGGCGGTTCCACAACTAAAGG TCTGCGTCTTCGGGGATCAGGAGCACTGTTATAAGGCCAAAGCCATAGGA GTTGATTGCCTAGATGTGGAGGCTTTGAAAAAGCTGAACAAAGATCCCAA GTTGACAAAGAAGTTGTCCAAAGCTTACGATGTCTTCCTGGCCTCCGAAT CGATAATTAAGCAGATCCCAAGGCTACTGGGTCCTGGTCTCACCAATGCG GGCAAATTTCTTACTCCTTTGGCTCGTGGCGAATCTATGAGTTCCAAAAT CAAAATACTATCTACCAAAAAGAAGCATATGAAAAGGATGGAATGTCTTT CCGTTAATGTTGGCCATGTTGGCATGCACCCAGAGGAACTAGCTCGAAAC ATAGCAATATCGATCAACTTTTTAGTGTCCTTGCTGAAGGATAACTGGCA GAATGTGCGCTCACTTCATATAAAATCATCGTTGGGCGTACCTCATCAGC TCTATTGAAAGTTTCCTAATCGAAAGTGTAAAGAGTAGTGTCTATTTGTG TAAAGTATGCGTGCAATAAAATTTCAGTATTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Aa-RA | 785 | RpL10Aa-RA | 1..782 | 1..782 | 3910 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 10862012..10862792 | 1..781 | 3905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15037366..15038147 | 1..782 | 3910 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 14778197..14778978 | 1..782 | 3910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 10862012..10862788 | 1..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..651 | 58..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..651 | 58..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..651 | 58..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..651 | 58..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..651 | 58..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..781 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..781 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..781 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..781 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Aa-RA | 1..781 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15037366..15038146 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15037366..15038146 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15037366..15038146 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 10863088..10863868 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14778197..14778977 | 1..781 | 100 | Plus |
Translation from 57 to 707
> AT11516.pep MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFH GSVLLHHLAVPQLKVCVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLT KKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKIKI LSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNV RSLHIKSSLGVPHQLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17830-PA | 217 | GF17830-PA | 1..217 | 1..216 | 644 | 59.6 | Plus |
Dana\GF24510-PA | 217 | GF24510-PA | 1..217 | 1..216 | 619 | 63.6 | Plus |
Dana\GF23437-PA | 143 | GF23437-PA | 1..106 | 63..181 | 165 | 40.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16888-PA | 216 | GG16888-PA | 1..216 | 1..216 | 1028 | 89.4 | Plus |
Dere\GG15534-PA | 217 | GG15534-PA | 1..217 | 1..216 | 615 | 63.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16724-PA | 217 | GH16724-PA | 1..217 | 1..216 | 602 | 62.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Aa-PA | 216 | CG3843-PA | 1..216 | 1..216 | 1113 | 100 | Plus |
RpL10Ab-PA | 217 | CG7283-PA | 1..217 | 1..216 | 676 | 63.6 | Plus |
RpL10Ab-PF | 57 | CG7283-PF | 1..53 | 1..53 | 147 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20818-PA | 154 | GL20818-PA | 1..144 | 1..144 | 395 | 64.6 | Plus |
Dper\GL20819-PA | 59 | GL20819-PA | 1..59 | 158..216 | 226 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20236-PA | 217 | GA20236-PA | 1..217 | 1..216 | 629 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24197-PA | 216 | GM24197-PA | 1..216 | 1..216 | 1085 | 94.9 | Plus |
Dsec\GM25301-PA | 217 | GM25301-PA | 1..217 | 1..216 | 616 | 63.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14333-PA | 217 | GD14333-PA | 1..217 | 1..216 | 616 | 63.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11814-PA | 217 | GJ11814-PA | 1..217 | 1..216 | 614 | 63.6 | Plus |
Translation from 57 to 707
> AT11516.hyp MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFH GSVLLHHLAVPQLKVCVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLT KKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKIKI LSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNV RSLHIKSSLGVPHQLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Aa-PA | 216 | CG3843-PA | 1..216 | 1..216 | 1113 | 100 | Plus |
RpL10Ab-PA | 217 | CG7283-PA | 1..217 | 1..216 | 676 | 63.6 | Plus |
RpL10Ab-PF | 57 | CG7283-PF | 1..53 | 1..53 | 147 | 60.4 | Plus |