Clone AT11516 Report

Search the DGRC for AT11516

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:115
Well:16
Vector:pOTB7
Associated Gene/TranscriptRpL10Aa-RA
Protein status:AT11516.pep: gold
Preliminary Size:651
Sequenced Size:799

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3843 2002-01-01 Sim4 clustering to Release 2
CG3843 2002-04-26 Blastp of sequenced clone
CG3843 2003-01-01 Sim4 clustering to Release 3
RpL10Aa 2008-04-29 Release 5.5 accounting
RpL10Aa 2008-08-15 Release 5.9 accounting
RpL10Aa 2008-12-18 5.12 accounting

Clone Sequence Records

AT11516.complete Sequence

799 bp (799 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113239

> AT11516.complete
ATTTTGTGCTTGTAGAATTGTTTAAATATTTTTGTTGCTCACAGCTGATC
ATAAATTATGGTGTCGAAAGTTTCTCGCGATACGATTTACGTTGCAGTCA
AAAATATCCTGCTGAACTCGCAGGCCAAAGGACCAGACTGCCTGGAGACG
GTGGAGCTGCAGATTGGGCTGAGGGATTATGATCCTGACAAATGCAAGCG
GTTCCATGGAAGTGTACTATTGCATCACCTGGCGGTTCCACAACTAAAGG
TCTGCGTCTTCGGGGATCAGGAGCACTGTTATAAGGCCAAAGCCATAGGA
GTTGATTGCCTAGATGTGGAGGCTTTGAAAAAGCTGAACAAAGATCCCAA
GTTGACAAAGAAGTTGTCCAAAGCTTACGATGTCTTCCTGGCCTCCGAAT
CGATAATTAAGCAGATCCCAAGGCTACTGGGTCCTGGTCTCACCAATGCG
GGCAAATTTCTTACTCCTTTGGCTCGTGGCGAATCTATGAGTTCCAAAAT
CAAAATACTATCTACCAAAAAGAAGCATATGAAAAGGATGGAATGTCTTT
CCGTTAATGTTGGCCATGTTGGCATGCACCCAGAGGAACTAGCTCGAAAC
ATAGCAATATCGATCAACTTTTTAGTGTCCTTGCTGAAGGATAACTGGCA
GAATGTGCGCTCACTTCATATAAAATCATCGTTGGGCGTACCTCATCAGC
TCTATTGAAAGTTTCCTAATCGAAAGTGTAAAGAGTAGTGTCTATTTGTG
TAAAGTATGCGTGCAATAAAATTTCAGTATTAAAAAAAAAAAAAAAAAA

AT11516.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Aa-RA 785 RpL10Aa-RA 1..782 1..782 3910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10862012..10862792 1..781 3905 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:45:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15037366..15038147 1..782 3910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14778197..14778978 1..782 3910 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:42:51 has no hits.

AT11516.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:43:59 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10862012..10862788 1..781 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:00:35 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:45 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:33 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:06 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:25 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..651 58..708 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:22 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:44 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:33 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:06 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:25 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Aa-RA 1..781 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:59 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15037366..15038146 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:59 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15037366..15038146 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:59 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15037366..15038146 1..781 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:33 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10863088..10863868 1..781 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:58 Download gff for AT11516.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14778197..14778977 1..781 100   Plus

AT11516.pep Sequence

Translation from 57 to 707

> AT11516.pep
MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFH
GSVLLHHLAVPQLKVCVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLT
KKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKIKI
LSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNV
RSLHIKSSLGVPHQLY*

AT11516.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17830-PA 217 GF17830-PA 1..217 1..216 644 59.6 Plus
Dana\GF24510-PA 217 GF24510-PA 1..217 1..216 619 63.6 Plus
Dana\GF23437-PA 143 GF23437-PA 1..106 63..181 165 40.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16888-PA 216 GG16888-PA 1..216 1..216 1028 89.4 Plus
Dere\GG15534-PA 217 GG15534-PA 1..217 1..216 615 63.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16724-PA 217 GH16724-PA 1..217 1..216 602 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Aa-PA 216 CG3843-PA 1..216 1..216 1113 100 Plus
RpL10Ab-PA 217 CG7283-PA 1..217 1..216 676 63.6 Plus
RpL10Ab-PF 57 CG7283-PF 1..53 1..53 147 60.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20818-PA 154 GL20818-PA 1..144 1..144 395 64.6 Plus
Dper\GL20819-PA 59 GL20819-PA 1..59 158..216 226 72.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20236-PA 217 GA20236-PA 1..217 1..216 629 65 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24197-PA 216 GM24197-PA 1..216 1..216 1085 94.9 Plus
Dsec\GM25301-PA 217 GM25301-PA 1..217 1..216 616 63.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14333-PA 217 GD14333-PA 1..217 1..216 616 63.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11814-PA 217 GJ11814-PA 1..217 1..216 614 63.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13682-PA 217 GK13682-PA 1..217 1..216 604 63.1 Plus
Dwil\GK25355-PA 140 GK25355-PA 1..133 1..144 284 54.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24270-PA 216 GE24270-PA 1..216 1..216 1028 89.4 Plus
Dyak\GE21853-PA 217 GE21853-PA 1..217 1..216 615 63.6 Plus

AT11516.hyp Sequence

Translation from 57 to 707

> AT11516.hyp
MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFH
GSVLLHHLAVPQLKVCVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLT
KKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKIKI
LSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNV
RSLHIKSSLGVPHQLY*

AT11516.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Aa-PA 216 CG3843-PA 1..216 1..216 1113 100 Plus
RpL10Ab-PA 217 CG7283-PA 1..217 1..216 676 63.6 Plus
RpL10Ab-PF 57 CG7283-PF 1..53 1..53 147 60.4 Plus