Clone AT11556 Report

Search the DGRC for AT11556

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:115
Well:56
Vector:pOTB7
Associated Gene/TranscriptAcam-RA
Protein status:AT11556.pep: gold
Preliminary Size:632
Sequenced Size:594

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17769 2001-12-16 Blastp of sequenced clone
CG17769 2002-01-01 Sim4 clustering to Release 2
And 2008-04-29 Release 5.5 accounting
And 2008-08-15 Release 5.9 accounting
And 2008-12-18 5.12 accounting

Clone Sequence Records

AT11556.complete Sequence

594 bp (594 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070783

> AT11556.complete
GTAAATTCCAACAGTCTATAGCTCTGCAAGCATTTAAAAATATCTCGATA
AATACCGAAAATCTTTGAAAATTTATCAAGATGTCCGAACTAACGGAGGA
GCAGATTGCCGAGTTCAAGGATGCCTTTGTCCAGTTCGACAAGGAGGGAA
CCGGCAAGATCGCCACCCGTGAGCTGGGCACATTGATGCGCACCTTGGGC
CAGAATCCAACGGAGGCCGAGTTGCAAGATTTGATAGCTGAGGCCGAGAA
CAACAACAATGGCCAACTGAACTTCACTGAGTTCTGCGGTATAATGGCCA
AGCAAATGCGGGAAACTGACACTGAGGAGGAAATGCGTGAGGCATTCAAG
ATTTTTGATCGTGATGGCGATGGCTTTATATCACCAGCTGAGCTTCGCTT
TGTGATGATCAATCTGGGCGAAAAGGTCACCGACGAGGAGATCGATGAGA
TGATTCGCGAGGCTGATTTTGATGGGGATGGCATGATCAACTACGAGGAA
TTCGTATGGATGATAAGCCAGAAGTAGTACAGCTACTTTAAATGAAATAA
AAATATTTGGGGTCACTGCATAAAAAAAAAAAAAAAAAAAAAAA

AT11556.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
And-RA 664 And-RA 26..604 1..579 2895 100 Plus
And-RB 1224 And-RB 654..1224 1..571 2855 100 Plus
CG17770-RA 1224 CG17770-RA 654..1224 1..571 2855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21635534..21636104 1..571 2855 100 Plus
chr2R 21145070 chr2R 8156558..8156631 402..475 205 85.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25812564..25813142 1..579 2895 100 Plus
2R 25286936 2R 12269339..12269412 402..475 205 85.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25553395..25553973 1..579 2895 100 Plus
2R 25260384 2R 12270538..12270611 402..475 205 85.1 Plus
2R 25260384 2R 12266032..12266087 171..226 160 85.7 Plus
Blast to na_te.dros performed on 2019-03-16 08:45:08 has no hits.

AT11556.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:45:49 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21635534..21636104 1..571 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:00:54 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 1..447 81..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:57 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RB 1..447 81..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:41 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
Acam-RA 1..447 81..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:29 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 1..447 81..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:18 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
Acam-RA 1..447 81..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:28 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 26..596 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:57 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 26..596 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:41 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 654..1224 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:29 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 26..596 1..571 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:18 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 654..1224 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:49 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25812564..25813134 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:49 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25812564..25813134 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:49 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25812564..25813134 1..571 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:41 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21638286..21638856 1..571 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:13 Download gff for AT11556.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25553395..25553965 1..571 100   Plus

AT11556.pep Sequence

Translation from 80 to 526

> AT11556.pep
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK*

AT11556.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16772-PA 148 GF16772-PA 1..148 1..148 669 85.1 Plus
Dana\GF12835-PA 149 GF12835-PA 4..149 3..148 534 67.8 Plus
Dana\GF13647-PA 148 GF13647-PA 1..148 1..148 344 42.6 Plus
Dana\GF13648-PA 151 GF13648-PA 15..145 11..141 329 51.1 Plus
Dana\GF16771-PA 165 GF16771-PA 21..165 4..148 286 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11425-PA 148 GG11425-PA 1..148 1..148 743 97.3 Plus
Dere\GG20265-PA 149 GG20265-PA 4..149 3..148 534 67.8 Plus
Dere\GG23316-PA 148 GG23316-PA 1..148 1..148 352 44.6 Plus
Dere\GG24968-PA 148 GG24968-PA 1..148 1..148 311 45.3 Plus
Dere\GG14636-PA 151 GG14636-PA 8..145 4..141 283 40.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23405-PA 151 GH23405-PA 6..151 3..148 547 67.8 Plus
Dgri\GH22800-PA 122 GH22800-PA 7..104 3..100 344 64.3 Plus
Dgri\GH21304-PA 151 GH21304-PA 8..146 4..142 329 46 Plus
Dgri\GH16787-PA 149 GH16787-PA 2..145 3..146 289 38.2 Plus
Dgri\GH10976-PA 190 GH10976-PA 42..186 3..147 288 43.4 Plus
Dgri\GH22800-PA 122 GH22800-PA 15..79 84..148 157 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Acam-PB 148 CG17769-PB 1..148 1..148 761 100 Plus
Acam-PA 148 CG17769-PA 1..148 1..148 761 100 Plus
Cam-PD 149 CG8472-PD 4..149 3..148 536 67.8 Plus
Cam-PC 149 CG8472-PC 4..149 3..148 536 67.8 Plus
Cam-PE 149 CG8472-PE 4..149 3..148 536 67.8 Plus
Cam-PB 149 CG8472-PB 4..149 3..148 536 67.8 Plus
Cam-PA 149 CG8472-PA 4..149 3..148 536 67.8 Plus
CG31960-PA 148 CG31960-PA 1..148 1..148 348 42.6 Plus
azot-PA 148 CG11165-PA 1..148 1..148 341 41.2 Plus
CG17493-PD 182 CG17493-PD 34..173 3..142 297 44.3 Plus
CG17493-PC 182 CG17493-PC 34..173 3..142 297 44.3 Plus
CG17493-PB 182 CG17493-PB 34..173 3..142 297 44.3 Plus
CG11638-PA 387 CG11638-PA 206..357 4..147 296 38.8 Plus
CG30378-PA 148 CG30378-PA 5..143 4..142 295 41.7 Plus
CG13898-PA 151 CG13898-PA 8..145 4..141 291 41.3 Plus
CG17770-PA 164 CG17770-PA 20..162 4..146 290 39.9 Plus
TpnC41C-PB 154 CG2981-PB 4..146 3..142 287 39.2 Plus
TpnC41C-PA 154 CG2981-PA 4..146 3..142 287 39.2 Plus
Mlc-c-PA 147 CG3201-PA 1..144 1..145 278 40.1 Plus
TpnC73F-PC 155 CG7930-PC 7..153 3..146 275 38.1 Plus
TpnC73F-PA 155 CG7930-PA 7..153 3..146 275 38.1 Plus
TpnC47D-PB 155 CG9073-PB 7..153 3..146 269 37.4 Plus
TpnC47D-PA 155 CG9073-PA 7..153 3..146 269 37.4 Plus
CG5024-PB 165 CG5024-PB 21..164 4..147 264 36.8 Plus
CG5024-PA 165 CG5024-PA 21..164 4..147 264 36.8 Plus
CG13526-PA 154 CG13526-PA 7..147 2..142 261 35.5 Plus
TpnC25D-PC 149 CG6514-PC 4..147 6..146 260 34.7 Plus
TpnC25D-PA 149 CG6514-PA 4..147 6..146 260 34.7 Plus
CG31802-PA 186 CG31802-PA 38..182 3..147 258 37.9 Plus
TpnC25D-PB 143 CG6514-PB 5..141 13..146 256 35.8 Plus
Mlc-c-PB 153 CG3201-PB 15..150 9..145 252 38.8 Plus
TpnC4-PB 153 CG12408-PB 5..152 3..146 244 30.4 Plus
TpnC4-PA 153 CG12408-PA 5..152 3..146 244 30.4 Plus
Eip63F-1-PC 181 CG15855-PC 21..180 5..145 231 31.9 Plus
Eip63F-1-PA 193 CG15855-PA 33..192 5..145 231 31.9 Plus
sqh-PE 174 CG3595-PE 30..160 6..141 227 35.3 Plus
sqh-PD 174 CG3595-PD 30..160 6..141 227 35.3 Plus
sqh-PC 174 CG3595-PC 30..160 6..141 227 35.3 Plus
sqh-PB 174 CG3595-PB 30..160 6..141 227 35.3 Plus
sqh-PA 174 CG3595-PA 30..160 6..141 227 35.3 Plus
Eip63F-1-PD 166 CG15855-PD 9..165 8..145 225 31.2 Plus
Eip63F-1-PB 161 CG15855-PB 9..160 13..145 216 31.6 Plus
CG11041-PB 155 CG11041-PB 4..148 3..142 181 32.4 Plus
CG17272-PA 149 CG17272-PA 7..138 6..142 180 32.1 Plus
CG11638-PA 387 CG11638-PA 137..275 6..146 173 36.3 Plus
Mlc2-PA 222 CG2184-PA 70..213 2..148 172 30 Plus
CG17237-PA 192 CG17237-PA 42..186 6..142 155 26 Plus
CG33098-PD 164 CG33098-PD 11..156 3..146 151 28.7 Plus
CG33098-PF 230 CG33098-PF 77..222 3..146 151 28.7 Plus
CG33098-PE 230 CG33098-PE 77..222 3..146 151 28.7 Plus
CG33098-PB 230 CG33098-PB 77..222 3..146 151 28.7 Plus
CanB2-PB 170 CG11217-PB 13..153 2..141 148 29.7 Plus
Eip63F-1-PC 181 CG15855-PC 26..90 83..147 141 41.5 Plus
Eip63F-1-PA 193 CG15855-PA 38..102 83..147 141 41.5 Plus
Eip63F-1-PD 166 CG15855-PD 12..75 84..147 140 42.2 Plus
Eip63F-1-PB 161 CG15855-PB 5..70 82..147 139 40.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10339-PA 149 GI10339-PA 3..149 2..148 559 70.1 Plus
Dmoj\GI20594-PA 149 GI20594-PA 4..149 3..148 534 67.8 Plus
Dmoj\GI10340-PA 150 GI10340-PA 4..150 2..148 501 63.3 Plus
Dmoj\GI19794-PA 151 GI19794-PA 8..146 4..142 325 48.2 Plus
Dmoj\GI19793-PA 149 GI19793-PA 1..148 1..148 294 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21535-PA 148 GL21535-PA 1..148 1..148 625 80.4 Plus
Dper\GL21536-PA 148 GL21536-PA 1..148 1..148 608 77.7 Plus
Dper\GL10814-PA 149 GL10814-PA 4..149 3..148 534 67.8 Plus
Dper\GL11704-PA 151 GL11704-PA 8..147 4..143 385 50 Plus
Dper\GL11703-PA 149 GL11703-PA 4..144 2..142 351 50.4 Plus
Dper\GL11703-PA 149 GL11703-PA 9..77 80..148 168 49.3 Plus
Dper\GL11704-PA 151 GL11704-PA 14..78 83..147 134 44.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14657-PA 148 GA14657-PA 1..148 1..148 625 80.4 Plus
Dpse\GA26322-PA 148 GA26322-PA 1..148 1..148 608 77.7 Plus
Dpse\GA24499-PA 149 GA24499-PA 4..149 3..148 534 67.8 Plus
Dpse\GA24240-PA 151 GA24240-PA 8..147 4..143 386 50 Plus
Dpse\GA24239-PA 149 GA24239-PA 4..144 2..142 357 50.4 Plus
Dpse\GA24239-PA 149 GA24239-PA 9..77 80..148 168 49.3 Plus
Dpse\GA24240-PA 151 GA24240-PA 14..78 83..147 134 44.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10265-PA 148 GM10265-PA 1..148 1..148 755 99.3 Plus
Dsec\GM21351-PA 149 GM21351-PA 4..149 3..148 534 67.8 Plus
Dsec\GM20994-PA 148 GM20994-PA 1..148 1..148 347 41.9 Plus
Dsec\GM18437-PA 148 GM18437-PA 1..148 1..148 307 43.2 Plus
Dsec\GM10264-PA 164 GM10264-PA 20..162 4..146 294 40.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21235-PA 148 GD21235-PA 1..148 1..148 755 99.3 Plus
Dsim\GD10849-PA 149 GD10849-PA 4..149 3..148 534 67.8 Plus
Dsim\GD10523-PA 148 GD10523-PA 1..148 1..148 346 41.2 Plus
Dsim\GD23255-PA 148 GD23255-PA 1..148 1..148 307 43.2 Plus
Dsim\GD10524-PA 117 GD10524-PA 1..117 32..148 305 44.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10193-PA 151 GJ10193-PA 6..151 3..148 549 69.9 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..113 36..148 418 67.3 Plus
Dvir\GJ15116-PA 151 GJ15116-PA 1..147 1..147 348 43.5 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 9..147 4..142 344 49.6 Plus
Dvir\GJ11809-PA 147 GJ11809-PA 2..147 3..148 342 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18988-PA 148 GK18988-PA 1..148 1..148 654 83.8 Plus
Dwil\GK22183-PA 149 GK22183-PA 4..149 3..148 534 67.8 Plus
Dwil\GK19414-PA 148 GK19414-PA 1..146 1..146 374 45.9 Plus
Dwil\GK21975-PA 147 GK21975-PA 1..142 1..142 337 47.9 Plus
Dwil\GK21454-PA 151 GK21454-PA 6..151 3..148 336 44.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23620-PA 148 GE23620-PA 1..148 1..148 744 97.3 Plus
Dyak\Cam-PA 149 GE12425-PA 4..149 3..148 534 67.8 Plus
Dyak\GE19161-PA 148 GE19161-PA 1..148 1..148 353 43.9 Plus
Dyak\GE18259-PA 148 GE18259-PA 1..148 1..148 339 43.9 Plus
Dyak\GE19162-PA 147 GE19162-PA 1..142 1..142 288 41.5 Plus

AT11556.hyp Sequence

Translation from 80 to 526

> AT11556.hyp
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK*

AT11556.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Acam-PB 148 CG17769-PB 1..148 1..148 761 100 Plus
Acam-PA 148 CG17769-PA 1..148 1..148 761 100 Plus
Cam-PD 149 CG8472-PD 4..149 3..148 536 67.8 Plus
Cam-PC 149 CG8472-PC 4..149 3..148 536 67.8 Plus
Cam-PE 149 CG8472-PE 4..149 3..148 536 67.8 Plus