Clone AT11570 Report

Search the DGRC for AT11570

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:115
Well:70
Vector:pOTB7
Associated Gene/Transcriptisopeptidase-T-3-RB
Protein status:AT11570.pep: gold
Preliminary Size:2478
Sequenced Size:1538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11025 2002-09-24 Blastp of sequenced clone
isopeptidase-T-3 2008-04-29 Release 5.5 accounting
isopeptidase-T-3 2008-08-15 Release 5.9 accounting
isopeptidase-T-3 2008-12-18 5.12 accounting

Clone Sequence Records

AT11570.complete Sequence

1538 bp (1538 high quality bases) assembled on 2002-09-24

GenBank Submission: BT001297

> AT11570.complete
CCGAAACAAATATTTGTCTTTCGAAATTCTCCGTTGGTTTGTCACTACCC
ATCCAACTAAAACAAACTATGCAAAAACTGCGCAGTTTGTTTCTCAGGAA
ATCAGCCCATACAAATCGCCCAGGTAGCTCTACTTCTGGCGAGGCAGACG
ATGCCAGCAGGCCAGGTGAATCTATCCTGGTGCGGGTAATCTGCCCCAGC
TCTCGGGTTCTTATCTTCAAAACGGACGTTAATAAGCGCCTAAACGAGCT
GAAGAGTGAGGTGATTCTGGAACTGAGCGACGATCCCGACTCCATCCAGC
TATTTGCCCCAGATGTGCGGCATCTTAATCCGCGATACCGTCTCTATCGG
GCGGAATACTTCGGCGGCGAGCTTAACGAGGGCGACACGCTGGCCCAGCT
AAAAGTTCGCAACAATGAGACTTTTATACTCTCTCCACGACGCAATACTC
TGCCGCAGACTGTTTCACGGATACGTGAGGTTCCTGGCCCAAATGAGCAG
CTGGTGGAGAGCGCCACCCGATACGTGCCCGTCAATTGCAACCAGCTGCC
CACCATCGATATTAATGAAATCTTTCAGCAGTCGAATATCCAATACGATG
TGCGAAAGGTGTTGATCTCTTTGGCTCAAGCTTCTGCGGCGGTTATAGGA
GCTGGCCCTTATGCTCCACGCCTGATAGCTATGCTAAAGCAACGTTTGAT
CAATCGCCGAAATCAGCAAGCGGATACGCTGCAATGCCTCGTGGACATGG
GCTTCAAGCGGGAGCTAGCCGCATTTGCCTTAAAAGCACACAATGGCATT
TACTCGACCACGATGGAGTGGCTAATACAGAACCAAAACGAGGAAAATCC
ACAGGAACCGCCGGGCATGAATATGCAGCACAGTCTATCTTCCATCTCAC
CCTCCACGATTGTCACCAATAATGAAACCATTGAAAACACTGCTGCCTTG
ATTGAGATTGTACGAATCTACAGCCACCGGGATTCCCCTCCCAGCGATGA
GATTGTAGAATCGCTTACAGAAATGGGCTTCGAGGAGACGGCAGTGCTTG
CGGCGCTGAAGAAAACTGGCAACAACAAGGCGTCCGCGTGCGAATGGTTG
TGCGACAATCGATCGGGTAGCGTTATTGAACTGCGTGAAGGCTTGGCGCC
CGATTCGCCCATCCTAAAGGTGATCCTGGAAATGCCACAAGTCCAGATGA
CCCTAAGCAATCCAAAGACTTTTTTGGCATTTCTGGGCATCCTGGAAAAC
GAACATGCGATACGCGTGTGGCGTGGCGACAACGACACAACCTCGGTCAT
CACACATATCCTTCAAAAGTACCATGAGGAGAAGCATGTGCTTGGCATCA
ATCAGTTCTATACGAACCGCTGGTGAAAGATGCCGCTAAGTGGCTTTACT
ATGAGATTAACCAAATTATATTTATACATATACATACACAATCACACACC
CGAAGTGCATGGCTGTAGCTTGGTCCATTTTGGGGCTCTAATTATACATT
GTGTATGTGCCCGTAAAAAAAAAAAAAAAAAAAAAAAA

AT11570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
isopeptidase-T-3-RB 2129 isopeptidase-T-3-RB 81..1595 1..1515 7500 99.6 Plus
isopeptidase-T-3.b 2660 isopeptidase-T-3.b 617..2131 1..1515 7500 99.6 Plus
isopeptidase-T-3.a 2490 isopeptidase-T-3.a 532..1961 86..1515 7075 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15558604..15559095 96..587 2460 100 Plus
chr2R 21145070 chr2R 15559151..15559487 588..924 1685 100 Plus
chr2R 21145070 chr2R 15559539..15559842 924..1227 1520 100 Plus
chr2R 21145070 chr2R 15559905..15560192 1227..1514 1440 100 Plus
chr2R 21145070 chr2R 15558443..15558540 1..98 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19671359..19671850 96..587 2430 99.6 Plus
2R 25286936 2R 19671906..19672242 588..924 1685 100 Plus
2R 25286936 2R 19672294..19672597 924..1227 1475 99 Plus
2R 25286936 2R 19672660..19672948 1227..1515 1445 100 Plus
2R 25286936 2R 19671199..19671296 1..98 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19672558..19673049 96..587 2430 99.5 Plus
2R 25260384 2R 19673105..19673441 588..924 1685 100 Plus
2R 25260384 2R 19673493..19673796 924..1227 1475 99 Plus
2R 25260384 2R 19673859..19674147 1227..1515 1445 100 Plus
2R 25260384 2R 19672398..19672495 1..98 490 100 Plus
Blast to na_te.dros performed 2019-03-15 13:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Circe 7450 Circe CIRC 7450bp 4186..4256 1431..1501 121 63.4 Plus

AT11570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:02:22 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15558443..15558539 1..97 100 -> Plus
chr2R 15558606..15559095 98..587 100 -> Plus
chr2R 15559151..15559486 588..923 100 -> Plus
chr2R 15559539..15559842 924..1227 100 -> Plus
chr2R 15559906..15560192 1228..1514 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:00:58 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 1..1308 69..1376 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:13:53 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 1..1308 69..1376 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:55:42 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 1..1308 69..1376 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:04:55 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 1..1308 69..1376 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:19:03 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 1..1308 69..1376 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:36:46 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 37..1550 1..1514 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:13:53 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 37..1550 1..1514 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:55:42 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 37..1550 1..1514 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:04:55 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 37..1550 1..1514 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:19:03 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
isopeptidase-T-3-RB 37..1550 1..1514 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:22 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19671199..19671295 1..97 100 -> Plus
2R 19671361..19671850 98..587 99 -> Plus
2R 19671906..19672241 588..923 100 -> Plus
2R 19672294..19672597 924..1227 99 -> Plus
2R 19672661..19672947 1228..1514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:22 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19671199..19671295 1..97 100 -> Plus
2R 19671361..19671850 98..587 99 -> Plus
2R 19671906..19672241 588..923 100 -> Plus
2R 19672294..19672597 924..1227 99 -> Plus
2R 19672661..19672947 1228..1514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:22 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19671199..19671295 1..97 100 -> Plus
2R 19671361..19671850 98..587 99 -> Plus
2R 19671906..19672241 588..923 100 -> Plus
2R 19672294..19672597 924..1227 99 -> Plus
2R 19672661..19672947 1228..1514 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:55:42 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15558704..15558800 1..97 100 -> Plus
arm_2R 15558866..15559355 98..587 99 -> Plus
arm_2R 15559411..15559746 588..923 100 -> Plus
arm_2R 15559799..15560102 924..1227 99 -> Plus
arm_2R 15560166..15560452 1228..1514 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:36:41 Download gff for AT11570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19672560..19673049 98..587 99 -> Plus
2R 19673105..19673440 588..923 100 -> Plus
2R 19673493..19673796 924..1227 99 -> Plus
2R 19673860..19674146 1228..1514 100   Plus
2R 19672398..19672494 1..97 100 -> Plus

AT11570.hyp Sequence

Translation from 2 to 1375

> AT11570.hyp
ETNICLSKFSVGLSLPIQLKQTMQKLRSLFLRKSAHTNRPGSSTSGEADD
ASRPGESILVRVICPSSRVLIFKTDVNKRLNELKSEVILELSDDPDSIQL
FAPDVRHLNPRYRLYRAEYFGGELNEGDTLAQLKVRNNETFILSPRRNTL
PQTVSRIREVPGPNEQLVESATRYVPVNCNQLPTIDINEIFQQSNIQYDV
RKVLISLAQASAAVIGAGPYAPRLIAMLKQRLINRRNQQADTLQCLVDMG
FKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEPPGMNMQHSLSSISP
STIVTNNETIENTAALIEIVRIYSHRDSPPSDEIVESLTEMGFEETAVLA
ALKKTGNNKASACEWLCDNRSGSVIELREGLAPDSPILKVILEMPQVQMT
LSNPKTFLAFLGILENEHAIRVWRGDNDTTSVITHILQKYHEEKHVLGIN
QFYTNRW*

AT11570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
isopeptidase-T-3-PB 435 CG11025-PB 1..435 23..457 2228 100 Plus
isopeptidase-T-3-PC 561 CG11025-PC 128..561 24..457 2206 99.1 Plus
isopeptidase-T-3-PA 557 CG11025-PA 133..557 33..457 2181 100 Plus

AT11570.pep Sequence

Translation from 68 to 1375

> AT11570.pep
MQKLRSLFLRKSAHTNRPGSSTSGEADDASRPGESILVRVICPSSRVLIF
KTDVNKRLNELKSEVILELSDDPDSIQLFAPDVRHLNPRYRLYRAEYFGG
ELNEGDTLAQLKVRNNETFILSPRRNTLPQTVSRIREVPGPNEQLVESAT
RYVPVNCNQLPTIDINEIFQQSNIQYDVRKVLISLAQASAAVIGAGPYAP
RLIAMLKQRLINRRNQQADTLQCLVDMGFKRELAAFALKAHNGIYSTTME
WLIQNQNEENPQEPPGMNMQHSLSSISPSTIVTNNETIENTAALIEIVRI
YSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCDNRSG
SVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENEHAIRV
WRGDNDTTSVITHILQKYHEEKHVLGINQFYTNRW*

AT11570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11731-PA 556 GF11731-PA 133..556 11..435 2102 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21992-PA 557 GG21992-PA 133..557 11..435 2205 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23012-PA 586 GH23012-PA 147..586 1..435 1826 77.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
isopeptidase-T-3-PB 435 CG11025-PB 1..435 1..435 2228 100 Plus
isopeptidase-T-3-PC 561 CG11025-PC 128..561 2..435 2206 99.1 Plus
isopeptidase-T-3-PA 557 CG11025-PA 133..557 11..435 2181 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21079-PA 359 GI21079-PA 131..356 14..238 940 78.3 Plus
Dmoj\GI21080-PA 167 GI21080-PA 1..167 269..435 819 89.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10356-PA 493 GL10356-PA 138..493 18..435 1367 65.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24943-PB 436 GA24943-PB 1..436 1..435 2004 85.6 Plus
Dpse\GA24943-PA 554 GA24943-PA 138..554 18..435 1951 86.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21979-PA 557 GM21979-PA 133..557 11..435 2278 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11475-PA 561 GD11475-PA 128..561 2..435 2303 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20925-PA 572 GJ20925-PA 136..572 1..435 1936 82.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15885-PA 572 GK15885-PA 154..572 19..435 1977 88.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12072-PA 557 GE12072-PA 133..557 11..435 2245 98.4 Plus