BDGP Sequence Production Resources |
Search the DGRC for AT11581
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 115 |
Well: | 81 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG13186-RA |
Protein status: | AT11581.pep: gold |
Preliminary Size: | 432 |
Sequenced Size: | 800 |
Gene | Date | Evidence |
---|---|---|
CG13186 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13186 | 2002-04-21 | Blastp of sequenced clone |
CG13186 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13186 | 2008-04-29 | Release 5.5 accounting |
CG13186 | 2008-08-15 | Release 5.9 accounting |
CG13186 | 2008-12-18 | 5.12 accounting |
800 bp (800 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113241
> AT11581.complete ATCACTTCGAAATTGTGAAAGTAATCTAAAAAAAAAACCACAATGCCACC AAAGAAGCCGGCAAAAAAGAAAAAGGACGTGGACTGGTCCTCCGATGAGC ATTTCTCCAAGGATCGTTCCATGATCTACATCGAGCACACGTACGAGTGT CCCATTTTCCAGACCAAGGCCGACGAGTGCGGAACATTCTTCACGCAACG GATACCGGAGCGCAAGTTCCAGCTGGTGAAGAATCGAAACGGACGCCAGG TTCCGCGGGAAGGAGCCTTCGAGATAGGTTTCTCGCAAAATGCACGCACC TCGGAGCATCTGCTGTGGTCCGGCTTGGAGAAGGGACCGCCGCGTCGGGA TAAGTTCCCACTGGACTACGAGGCACTGGTGCCCGATGTGAACAGGATAC TCAAGAAATTCTATCCCGACAAGGCGGTGGGCGTGGACGCTGACGACGGA GATGAGGAGAAAGAGGACATGTAAACATTTGCCGCACTTTGTTGTCTGAA TTATTATAAAGTCTTTACCATAACAATGGCTAATACATGGCGTGAAAAGT AAACAATCAGCCAGAGACCTGTTGGAGCAACTTTAAGACGTCATCCACCC ACGCGGACAAAATGCTCGGCGATTAGTGCGATTCTTCTTTGGCTTTTGTG TGTGTAATATTGCTGGTATTGTTGACTGACGTACTGACATCACACTTTGA CAGCTCCTTTCAAAAGTTAAATGCTTAAATCGACCAGAATAATTAACCCA ATACAATGCTGCCACATTAGCAGCCACACGATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13186-RA | 782 | CG13186-RA | 1..782 | 1..782 | 3880 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 7968497..7969278 | 1..782 | 3865 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12081276..12082058 | 1..783 | 3885 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12082475..12083257 | 1..783 | 3885 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7968497..7969278 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..432 | 43..474 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..432 | 43..474 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..432 | 43..474 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..432 | 43..474 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..432 | 43..474 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..782 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..782 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..782 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..782 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13186-RA | 1..782 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12081276..12082057 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12081276..12082057 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12081276..12082057 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7968781..7969562 | 1..782 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12082475..12083256 | 1..782 | 99 | Plus |
Translation from 42 to 473
> AT11581.pep MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFF TQRIPERKFQLVKNRNGRQVPREGAFEIGFSQNARTSEHLLWSGLEKGPP RRDKFPLDYEALVPDVNRILKKFYPDKAVGVDADDGDEEKEDM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12290-PA | 116 | GF12290-PA | 1..104 | 27..131 | 476 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20244-PA | 142 | GG20244-PA | 12..131 | 12..131 | 611 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20859-PA | 135 | GH20859-PA | 5..135 | 8..143 | 504 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13186-PA | 143 | CG13186-PA | 1..143 | 1..143 | 775 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20966-PA | 134 | GI20966-PA | 3..134 | 6..143 | 520 | 71.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17098-PA | 137 | GL17098-PA | 12..136 | 14..138 | 524 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12102-PA | 128 | GA12102-PA | 2..127 | 13..138 | 521 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21331-PA | 143 | GM21331-PA | 12..143 | 12..143 | 655 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10839-PA | 143 | GD10839-PA | 12..133 | 12..133 | 617 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20686-PA | 135 | GJ20686-PA | 1..134 | 1..137 | 531 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21341-PA | 144 | GK21341-PA | 1..139 | 1..138 | 544 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12404-PA | 141 | GE12404-PA | 12..141 | 12..143 | 645 | 93.2 | Plus |
Translation from 42 to 473
> AT11581.hyp MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFF TQRIPERKFQLVKNRNGRQVPREGAFEIGFSQNARTSEHLLWSGLEKGPP RRDKFPLDYEALVPDVNRILKKFYPDKAVGVDADDGDEEKEDM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13186-PA | 143 | CG13186-PA | 1..143 | 1..143 | 775 | 100 | Plus |