Clone AT11581 Report

Search the DGRC for AT11581

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:115
Well:81
Vector:pOTB7
Associated Gene/TranscriptCG13186-RA
Protein status:AT11581.pep: gold
Preliminary Size:432
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13186 2002-01-01 Sim4 clustering to Release 2
CG13186 2002-04-21 Blastp of sequenced clone
CG13186 2003-01-01 Sim4 clustering to Release 3
CG13186 2008-04-29 Release 5.5 accounting
CG13186 2008-08-15 Release 5.9 accounting
CG13186 2008-12-18 5.12 accounting

Clone Sequence Records

AT11581.complete Sequence

800 bp (800 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113241

> AT11581.complete
ATCACTTCGAAATTGTGAAAGTAATCTAAAAAAAAAACCACAATGCCACC
AAAGAAGCCGGCAAAAAAGAAAAAGGACGTGGACTGGTCCTCCGATGAGC
ATTTCTCCAAGGATCGTTCCATGATCTACATCGAGCACACGTACGAGTGT
CCCATTTTCCAGACCAAGGCCGACGAGTGCGGAACATTCTTCACGCAACG
GATACCGGAGCGCAAGTTCCAGCTGGTGAAGAATCGAAACGGACGCCAGG
TTCCGCGGGAAGGAGCCTTCGAGATAGGTTTCTCGCAAAATGCACGCACC
TCGGAGCATCTGCTGTGGTCCGGCTTGGAGAAGGGACCGCCGCGTCGGGA
TAAGTTCCCACTGGACTACGAGGCACTGGTGCCCGATGTGAACAGGATAC
TCAAGAAATTCTATCCCGACAAGGCGGTGGGCGTGGACGCTGACGACGGA
GATGAGGAGAAAGAGGACATGTAAACATTTGCCGCACTTTGTTGTCTGAA
TTATTATAAAGTCTTTACCATAACAATGGCTAATACATGGCGTGAAAAGT
AAACAATCAGCCAGAGACCTGTTGGAGCAACTTTAAGACGTCATCCACCC
ACGCGGACAAAATGCTCGGCGATTAGTGCGATTCTTCTTTGGCTTTTGTG
TGTGTAATATTGCTGGTATTGTTGACTGACGTACTGACATCACACTTTGA
CAGCTCCTTTCAAAAGTTAAATGCTTAAATCGACCAGAATAATTAACCCA
ATACAATGCTGCCACATTAGCAGCCACACGATAAAAAAAAAAAAAAAAAA

AT11581.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13186-RA 782 CG13186-RA 1..782 1..782 3880 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7968497..7969278 1..782 3865 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12081276..12082058 1..783 3885 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12082475..12083257 1..783 3885 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 08:46:17 has no hits.

AT11581.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:47:27 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7968497..7969278 1..782 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:00:59 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..432 43..474 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:37 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..432 43..474 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:54 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..432 43..474 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:05 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..432 43..474 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:57 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..432 43..474 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:56 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:37 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:54 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:05 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:57 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
CG13186-RA 1..782 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:27 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12081276..12082057 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:27 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12081276..12082057 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:27 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12081276..12082057 1..782 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:54 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7968781..7969562 1..782 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:38 Download gff for AT11581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12082475..12083256 1..782 99   Plus

AT11581.pep Sequence

Translation from 42 to 473

> AT11581.pep
MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFF
TQRIPERKFQLVKNRNGRQVPREGAFEIGFSQNARTSEHLLWSGLEKGPP
RRDKFPLDYEALVPDVNRILKKFYPDKAVGVDADDGDEEKEDM*

AT11581.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12290-PA 116 GF12290-PA 1..104 27..131 476 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20244-PA 142 GG20244-PA 12..131 12..131 611 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20859-PA 135 GH20859-PA 5..135 8..143 504 70.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13186-PA 143 CG13186-PA 1..143 1..143 775 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20966-PA 134 GI20966-PA 3..134 6..143 520 71.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17098-PA 137 GL17098-PA 12..136 14..138 524 74.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12102-PA 128 GA12102-PA 2..127 13..138 521 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21331-PA 143 GM21331-PA 12..143 12..143 655 92.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10839-PA 143 GD10839-PA 12..133 12..133 617 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20686-PA 135 GJ20686-PA 1..134 1..137 531 73.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21341-PA 144 GK21341-PA 1..139 1..138 544 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12404-PA 141 GE12404-PA 12..141 12..143 645 93.2 Plus

AT11581.hyp Sequence

Translation from 42 to 473

> AT11581.hyp
MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFF
TQRIPERKFQLVKNRNGRQVPREGAFEIGFSQNARTSEHLLWSGLEKGPP
RRDKFPLDYEALVPDVNRILKKFYPDKAVGVDADDGDEEKEDM*

AT11581.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13186-PA 143 CG13186-PA 1..143 1..143 775 100 Plus