Clone AT11641 Report

Search the DGRC for AT11641

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:116
Well:41
Vector:pOTB7
Associated Gene/TranscriptCG5561-RA
Protein status:AT11641.pep: gold
Preliminary Size:918
Sequenced Size:1109

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5561 2002-01-01 Sim4 clustering to Release 2
CG5561 2002-05-21 Blastp of sequenced clone
CG5561 2008-04-29 Release 5.5 accounting
CG5561 2008-08-15 Release 5.9 accounting
CG5561 2008-12-18 5.12 accounting

Clone Sequence Records

AT11641.complete Sequence

1109 bp (1109 high quality bases) assembled on 2002-05-21

GenBank Submission: AY118278

> AT11641.complete
TTCTAGTGTAAATTTTCATACTTTTAGACCTTGATACAGATAATGTTGAT
ATAAATTCGCTGAAAATTTCTCCAGTCCTAGAATTCTTCTGGTAGAAAAG
GAAGATGTGCACTTTTGGCTGCAGGACATGCAAATCTCAACCAGATTGTG
AGGGCTGTTCCCCAAAGTGCTGCAGTCCTTGTATCAGCTACTGCATTTTC
GATCTAGAAAGTGCTGTCTTTGATACTCGCCACGTCTACCGGAAGGCTCT
CAAGGAACTGGTCCGTTGTTACGATAAGAGGATACCAGACATTTTACATG
TCCAAAGTGGACCTATGACGATATCAGAGATGTCTGAACTTTTTTGCCGG
AAGCTCGATATTCCGATGAGTTGGGAATCGTTTCGGTATGAACTTAACGA
GCGAACCTCCCATTTGATTGCAAATCCCCCGTTTATGGATGGGATTGAGC
GGCTTGTTCCGCACCTGCGCAATAGCTGCATGGAATTGGGCTTGATCACC
TCCAGCAACGAGGCCAACTACTGCTCGAAGATCCGCGGCCGGGAGGACTT
CTTTGAGAACTTCTCCACCGTGGTCTGTGCGGATGATCCGGAGTTGCGGG
CACCCAAACCCGAGCCCGACGTCTACCTGATTGCCATGTCGAGGCTAGGG
GATGCTGGACCTGATTGCACCCTGGTTTTCGATGGCACTCCCAAAGGAGT
TCAGGCGGCGAGCGATGCTCGACTGCCCGTCATAATGTTGGCCGAAAAGG
ACCTTCCCTGCTGTTGGTCCGAATTGGCCGCCTTGCGCTTCGAGTACCTG
GACGACTTCGAGCCGGAGATGTATAATTTGCCCCCATTTACGGACCCTGC
GCCCAAGAGGCGATCGAGTCGTCGGCGCACGAGATACAGTCAAAGATTGA
CCGTAATCCGGGCAAGAGCGGCCGAAGCAGCTGCCGCGGAGGAGGCGGAG
GCAGAGGAGGAGGAACCCGCCGAACCACCACCACCAGCCGCCCTACCATC
CATTTTAAATTTAAGAGAATAAGTCACGTTTTAGAAATGATTTATAAGAT
ATCAAATATTTTATAAGTTAATAAAAATATGTCGTTCTTGCAAAAAAAAA
AAAAAAAAA

AT11641.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5561-RA 1091 CG5561-RA 1..1091 1..1091 5455 100 Plus
CG5556-RA 1122 CG5556-RA 526..801 541..816 435 77.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1352829..1353698 1091..222 4290 99.5 Minus
chr2L 23010047 chr2L 1353747..1353968 222..1 1080 99.1 Minus
chr2L 23010047 chr2L 1351903..1352178 816..541 435 77.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1352967..1353839 1094..222 4365 100 Minus
2L 23513712 2L 1353888..1354109 222..1 1110 100 Minus
2L 23513712 2L 1352048..1352323 816..541 435 77.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1352967..1353839 1094..222 4365 100 Minus
2L 23513712 2L 1353888..1354109 222..1 1110 100 Minus
2L 23513712 2L 1352048..1352323 816..541 435 77.1 Minus
Blast to na_te.dros performed 2019-03-15 23:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1326..1410 999..1088 150 66.7 Plus

AT11641.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:22:55 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1352829..1353697 223..1091 99 <- Minus
chr2L 1353747..1353968 1..222 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:01:02 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..918 105..1022 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:38:26 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..918 105..1022 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:39:35 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..918 105..1022 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:30:09 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..918 105..1022 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:00 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..918 105..1022 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:11:19 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:38:26 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:39:35 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:30:09 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:00 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
CG5561-RA 1..1091 1..1091 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:55 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1352970..1353838 223..1091 100 <- Minus
2L 1353888..1354109 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:55 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1352970..1353838 223..1091 100 <- Minus
2L 1353888..1354109 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:55 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1352970..1353838 223..1091 100 <- Minus
2L 1353888..1354109 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:39:35 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1352970..1353838 223..1091 100 <- Minus
arm_2L 1353888..1354109 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:02:43 Download gff for AT11641.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1352970..1353838 223..1091 100 <- Minus
2L 1353888..1354109 1..222 100   Minus

AT11641.pep Sequence

Translation from 104 to 1021

> AT11641.pep
MCTFGCRTCKSQPDCEGCSPKCCSPCISYCIFDLESAVFDTRHVYRKALK
ELVRCYDKRIPDILHVQSGPMTISEMSELFCRKLDIPMSWESFRYELNER
TSHLIANPPFMDGIERLVPHLRNSCMELGLITSSNEANYCSKIRGREDFF
ENFSTVVCADDPELRAPKPEPDVYLIAMSRLGDAGPDCTLVFDGTPKGVQ
AASDARLPVIMLAEKDLPCCWSELAALRFEYLDDFEPEMYNLPPFTDPAP
KRRSSRRRTRYSQRLTVIRARAAEAAAAEEAEAEEEEPAEPPPPAALPSI
LNLRE*

AT11641.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14727-PA 298 GF14727-PA 1..254 1..252 909 65.7 Plus
Dana\GF14724-PA 240 GF14724-PA 5..231 21..245 237 27.6 Plus
Dana\GF24022-PA 304 GF24022-PA 95..304 40..247 232 28.3 Plus
Dana\GF19687-PA 241 GF19687-PA 11..239 5..243 209 24.6 Plus
Dana\GF14725-PA 240 GF14725-PA 5..231 21..245 198 23.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24599-PA 241 GG24599-PA 1..229 1..229 1144 93 Plus
Dere\GG24600-PA 297 GG24600-PA 1..246 1..246 950 69.1 Plus
Dere\GG24373-PA 304 GG24373-PA 95..304 40..247 224 28.4 Plus
Dere\GG24597-PA 240 GG24597-PA 9..240 16..245 215 25 Plus
Dere\GG24596-PA 153 GG24596-PA 1..142 105..243 178 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11411-PA 303 GH11411-PA 32..245 28..242 591 52.3 Plus
Dgri\GH10332-PA 238 GH10332-PA 10..231 27..247 316 30.2 Plus
Dgri\GH11658-PA 304 GH11658-PA 95..304 40..247 229 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5561-PA 305 CG5561-PA 1..305 1..305 1638 100 Plus
CG5556-PB 299 CG5556-PB 1..297 1..290 1007 63.3 Plus
CG5556-PA 299 CG5556-PA 1..297 1..290 1007 63.3 Plus
Gs1l-PA 231 CG15441-PA 9..231 27..247 286 30.9 Plus
Gs1l-PB 231 CG15441-PB 9..231 27..247 259 27.4 Plus
CG5565-PA 240 CG5565-PA 5..231 21..245 253 28.5 Plus
CG31924-PB 236 CG31924-PB 5..235 16..244 205 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18114-PA 299 GI18114-PA 39..260 28..251 628 54.2 Plus
Dmoj\GI17090-PA 240 GI17090-PA 8..231 23..245 292 29.5 Plus
Dmoj\GI17960-PA 304 GI17960-PA 95..304 40..247 236 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14891-PA 287 GL14891-PA 10..239 17..246 777 61.7 Plus
Dper\GL14859-PA 240 GL14859-PA 4..231 21..245 271 28.1 Plus
Dper\GL15658-PA 240 GL15658-PA 4..231 21..245 270 28.1 Plus
Dper\GL15404-PA 304 GL15404-PA 95..304 40..247 246 29.5 Plus
Dper\GL15659-PA 236 GL15659-PA 8..236 19..245 238 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25376-PA 394 GA25376-PA 10..239 17..246 786 62.2 Plus
Dpse\GA25358-PA 240 GA25358-PA 4..231 21..245 271 28.1 Plus
Dpse\GA18974-PA 240 GA18974-PA 4..231 21..245 271 28.1 Plus
Dpse\GA25364-PA 236 GA25364-PA 8..236 19..245 246 28.4 Plus
Dpse\GA13732-PA 304 GA13732-PA 95..304 40..247 246 29.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16615-PA 304 GM16615-PA 1..304 1..305 1545 97 Plus
Dsec\GM16616-PA 299 GM16616-PA 1..275 1..275 952 62.9 Plus
Dsec\GM16613-PA 240 GM16613-PA 3..231 19..245 259 28.7 Plus
Dsec\GM18089-PA 304 GM18089-PA 95..304 40..247 205 27.1 Plus
Dsec\GM16614-PA 216 GM16614-PA 27..216 43..245 183 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22914-PA 274 GD22914-PA 1..240 1..257 1031 74.3 Plus
Dsim\GD22912-PA 240 GD22912-PA 3..231 19..245 261 28.7 Plus
Dsim\GD22707-PA 304 GD22707-PA 95..304 40..247 212 27.6 Plus
Dsim\GD22913-PA 216 GD22913-PA 27..216 43..245 187 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17047-PA 308 GJ17047-PA 39..252 28..242 645 57.4 Plus
Dvir\GJ10810-PA 240 GJ10810-PA 8..233 23..247 284 28.3 Plus
Dvir\GJ17733-PA 304 GJ17733-PA 95..304 40..247 235 27.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14950-PA 294 GK14950-PA 1..266 1..263 708 49.8 Plus
Dwil\GK13331-PA 238 GK13331-PA 16..238 27..247 265 28.3 Plus
Dwil\GK15189-PA 240 GK15189-PA 10..231 27..245 236 26.1 Plus
Dwil\GK19038-PA 243 GK19038-PA 12..240 19..245 227 25.8 Plus
Dwil\GK23925-PA 304 GK23925-PA 95..304 40..247 212 25.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15655-PA 304 GE15655-PA 1..304 1..305 1308 90.5 Plus
Dyak\GE15666-PA 301 GE15666-PA 1..278 1..271 946 61.5 Plus
Dyak\GE15633-PA 240 GE15633-PA 3..231 20..245 249 27.5 Plus
Dyak\GE14717-PA 304 GE14717-PA 95..304 40..247 225 28.9 Plus
Dyak\GE15644-PA 240 GE15644-PA 20..240 27..245 220 25.8 Plus

AT11641.hyp Sequence

Translation from 104 to 1021

> AT11641.hyp
MCTFGCRTCKSQPDCEGCSPKCCSPCISYCIFDLESAVFDTRHVYRKALK
ELVRCYDKRIPDILHVQSGPMTISEMSELFCRKLDIPMSWESFRYELNER
TSHLIANPPFMDGIERLVPHLRNSCMELGLITSSNEANYCSKIRGREDFF
ENFSTVVCADDPELRAPKPEPDVYLIAMSRLGDAGPDCTLVFDGTPKGVQ
AASDARLPVIMLAEKDLPCCWSELAALRFEYLDDFEPEMYNLPPFTDPAP
KRRSSRRRTRYSQRLTVIRARAAEAAAAEEAEAEEEEPAEPPPPAALPSI
LNLRE*

AT11641.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5561-PA 305 CG5561-PA 1..305 1..305 1638 100 Plus
CG5556-PB 299 CG5556-PB 1..297 1..290 1007 63.3 Plus
CG5556-PA 299 CG5556-PA 1..297 1..290 1007 63.3 Plus
Gs1l-PA 231 CG15441-PA 9..231 27..247 286 30.9 Plus
Gs1l-PB 231 CG15441-PB 9..231 27..247 259 27.4 Plus