Clone AT11648 Report

Search the DGRC for AT11648

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:116
Well:48
Vector:pOTB7
Associated Gene/TranscriptCG14354-RA
Protein status:AT11648.pep: gold
Preliminary Size:897
Sequenced Size:1060

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14354 2002-01-01 Sim4 clustering to Release 2
CG14354 2002-02-22 Blastp of sequenced clone
CG14354 2003-01-01 Sim4 clustering to Release 3
CG14354 2008-04-29 Release 5.5 accounting
CG14354 2008-08-15 Release 5.9 accounting
CG14354 2008-12-18 5.12 accounting

Clone Sequence Records

AT11648.complete Sequence

1060 bp (1060 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089313

> AT11648.complete
AACTACTTGAAATGTAAAAATGTTCGAGCCTTGAGTTGAAAAGGCAAACT
TGGCAGCAACTTTGAAGGTTCACATAATTATGCGCATTGCCTTGCCACGG
CTCCTGTGCCACATCCTTCTCTATCACCTGCTCATGATCTCGTCCAGCCT
TGCAGCCTGCTACCAACGTCATTCGAGTTGCCCGCAGAACCAGCAGCAGT
CCAGATCCCAGCTTCTGGACCAGTCCGCGGACCTCACCATGGGCATAAGA
CAAGGCAACTCCAAGCAGACCGCCTCGAATATTGCCCAGAAGGCTGCCCA
GGAGGCCAAGAAGGCGTCGGACACTCAGGCACCAGCTGCTCTGGCTGCTG
CCCGCCAGGTGAAACACCAGCTGGCCGAGAAAGCCATTGCTGCGGCCAAG
GCCGCTGAGGCGGCGCTGGCGGGGAAACAACAACTTATGGAGCAGCTGCA
GGACGAGGTGCACGAGGCGGAGATTATTGTGCAGGAGGAAACCTACTCAC
TGGTTGGTTCACAGACAAATGTCAATGTCGCTGTTGCCACAGCGAAGCAA
TGTCAAACGCTGTTGCAATCGCTTCGGAGCTCAGTAAAAGTTGCCGAGGA
GGCAGTGAGCAATGCTGAGGCAGCTGCATCCGGTGCCCAGCAGGAGTTGT
GCGAAAAGAACCAGCTGGTGGAAACCGCTCGCCAGAGAGCAGAGATGCTG
ATGCAGCAGCTGCGCTCCGCCAAACTGGACTATACCAACACGAGGAAGGC
CGCCTACAGGGCTGCCTGTGCCGCCAACGAAGCAAGGAACAAGGCTGTAA
GGGACCGAAGATCCTACGAGGAGGACATCGGTGGAACTTTTGGGCAGCAG
CAGCAGCAGCAGCAACAAATGCTGCACAATCACGACCAGCCAGGAAATCT
CCAAGATCCAGAAGTTAAAGGACAGGTGGAGGGATGGGAGTATAATGAGC
AGGGTAAAGCTATATTTTCTAATTGATGTGCCCTGTAAAATACATATTAT
TTTGCTAAAATAGTTTAAAAAAAAAATGTATTAAAAGGACCAAAAAAAAA
AAAAAAAAAA

AT11648.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14354-RA 1089 CG14354-RA 40..1083 1..1044 5220 100 Plus
CG11694-RA 883 CG11694-RA 284..430 343..489 240 77.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21639018..21639547 512..1041 2650 100 Plus
chr3R 27901430 chr3R 21638452..21638965 1..514 2570 100 Plus
chr3R 27901430 chr3R 4137671..4137879 489..281 250 74.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25816045..25816577 512..1044 2665 100 Plus
3R 32079331 3R 25815479..25815992 1..514 2570 100 Plus
3R 32079331 3R 8311656..8311864 489..281 250 74.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25556876..25557408 512..1044 2665 100 Plus
3R 31820162 3R 25556310..25556823 1..514 2570 100 Plus
3R 31820162 3R 8052487..8052633 489..343 240 77.5 Minus
Blast to na_te.dros performed on 2019-03-15 15:15:22 has no hits.

AT11648.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:16:02 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21638452..21638965 1..514 100 -> Plus
chr3R 21639021..21639547 515..1041 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:01:09 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..897 80..976 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:38:07 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..897 80..976 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:09:34 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..897 80..976 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:41 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..897 80..976 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:21 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..897 80..976 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:14 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..1041 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:38:07 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..1041 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:09:34 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..1041 1..1041 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:41 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..1041 1..1041 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:21 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
CG14354-RA 1..1041 1..1041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:02 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25815479..25815992 1..514 100 -> Plus
3R 25816048..25816574 515..1041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:02 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25815479..25815992 1..514 100 -> Plus
3R 25816048..25816574 515..1041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:02 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25815479..25815992 1..514 100 -> Plus
3R 25816048..25816574 515..1041 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:09:34 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21641201..21641714 1..514 100 -> Plus
arm_3R 21641770..21642296 515..1041 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:46 Download gff for AT11648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25556310..25556823 1..514 100 -> Plus
3R 25556879..25557405 515..1041 100   Plus

AT11648.hyp Sequence

Translation from 79 to 975

> AT11648.hyp
MRIALPRLLCHILLYHLLMISSSLAACYQRHSSCPQNQQQSRSQLLDQSA
DLTMGIRQGNSKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAE
KAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNV
AVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETA
RQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRRSYEEDI
GGTFGQQQQQQQQMLHNHDQPGNLQDPEVKGQVEGWEYNEQGKAIFSN*

AT11648.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14354-PA 298 CG14354-PA 1..298 1..298 1481 100 Plus
CG11694-PA 261 CG11694-PA 17..248 11..247 494 49.8 Plus
CG14840-PA 300 CG14840-PA 81..267 58..244 485 56.1 Plus
CG14841-PA 274 CG14841-PA 32..266 16..245 427 44.3 Plus
CG34459-PC 305 CG34459-PC 112..295 56..239 416 47.8 Plus

AT11648.pep Sequence

Translation from 79 to 975

> AT11648.pep
MRIALPRLLCHILLYHLLMISSSLAACYQRHSSCPQNQQQSRSQLLDQSA
DLTMGIRQGNSKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAE
KAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNV
AVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETA
RQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRRSYEEDI
GGTFGQQQQQQQQMLHNHDQPGNLQDPEVKGQVEGWEYNEQGKAIFSN*

AT11648.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16773-PA 273 GF16773-PA 1..273 1..298 516 52.1 Plus
Dana\GF16670-PA 204 GF16670-PA 6..166 62..222 296 57.8 Plus
Dana\GF23051-PA 286 GF23051-PA 82..244 61..223 247 43.6 Plus
Dana\GF11413-PA 470 GF11413-PA 146..271 93..218 222 42.9 Plus
Dana\GF23178-PA 296 GF23178-PA 93..281 56..244 208 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11426-PA 286 GG11426-PA 1..286 1..298 815 78.6 Plus
Dere\GG17458-PA 259 GG17458-PA 44..246 46..247 309 55.7 Plus
Dere\GG20633-PA 462 GG20633-PA 103..286 56..239 307 47.8 Plus
Dere\GG21383-PA 244 GG21383-PA 41..230 55..244 233 48.4 Plus
Dere\GG21391-PA 298 GG21391-PA 81..265 60..244 230 56.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17423-PA 238 GH17423-PA 39..226 60..247 344 60.1 Plus
Dgri\GH14746-PA 293 GH14746-PA 81..268 60..248 280 48.1 Plus
Dgri\GH19706-PA 199 GH19706-PA 1..199 46..244 274 43.2 Plus
Dgri\GH19678-PA 273 GH19678-PA 57..250 41..244 244 53.9 Plus
Dgri\GH19677-PA 263 GH19677-PA 73..257 60..244 226 54.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14354-PA 298 CG14354-PA 1..298 1..298 1481 100 Plus
CG11694-PA 261 CG11694-PA 17..248 11..247 494 49.8 Plus
CG14840-PA 300 CG14840-PA 81..267 58..244 485 56.1 Plus
CG14841-PA 274 CG14841-PA 32..266 16..245 427 44.3 Plus
CG34459-PC 305 CG34459-PC 112..295 56..239 416 47.8 Plus
CG34459-PB 305 CG34459-PB 112..295 56..239 416 47.8 Plus
CG34459-PA 305 CG34459-PA 112..295 56..239 416 47.8 Plus
CG14839-PA 282 CG14839-PA 78..256 60..238 365 45.3 Plus
CG12985-PA 370 CG12985-PA 117..307 60..250 329 38.7 Plus
CG11698-PA 262 CG11698-PA 51..224 65..238 237 33.3 Plus
CG33257-PA 330 CG33257-PA 96..268 67..239 217 30.6 Plus
CG11693-PA 318 CG11693-PA 111..283 67..239 195 32.4 Plus
CG11693-PB 323 CG11693-PB 116..288 67..239 195 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22752-PA 265 GI22752-PA 68..254 61..247 328 57.8 Plus
Dmoj\GI10341-PA 307 GI10341-PA 92..266 54..228 287 45.8 Plus
Dmoj\GI20828-PA 301 GI20828-PA 86..289 51..245 282 43.1 Plus
Dmoj\GI23042-PA 269 GI23042-PA 82..263 57..238 271 45.1 Plus
Dmoj\GI24533-PA 270 GI24533-PA 55..252 47..244 270 49.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21537-PA 289 GL21537-PA 1..263 1..256 435 50.7 Plus
Dper\GL24119-PA 264 GL24119-PA 63..239 59..235 332 55.4 Plus
Dper\GL24243-PA 262 GL24243-PA 79..240 60..238 261 40 Plus
Dper\GL17739-PA 409 GL17739-PA 113..296 56..239 258 45.7 Plus
Dper\GL23292-PA 280 GL23292-PA 71..258 58..244 210 53.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26323-PA 289 GA26323-PA 1..263 1..256 434 50.4 Plus
Dpse\GA11146-PB 267 GA11146-PB 66..254 59..247 363 54.5 Plus
Dpse\GA13285-PA 246 GA13285-PA 46..224 60..238 292 45.8 Plus
Dpse\GA27677-PA 402 GA27677-PA 109..292 56..239 265 46.7 Plus
Dpse\GA13287-PA 278 GA13287-PA 71..260 55..244 208 45.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10266-PA 296 GM10266-PA 1..296 1..298 1191 91.3 Plus
Dsec\GM26352-PA 261 GM26352-PA 4..223 1..222 299 48.5 Plus
Dsec\GM21727-PA 455 GM21727-PA 96..279 56..239 282 47.3 Plus
Dsec\GM25864-PA 302 GM25864-PA 81..267 58..244 260 56.7 Plus
Dsec\GM25863-PA 265 GM25863-PA 32..260 16..239 254 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21236-PA 296 GD21236-PA 1..296 1..298 1148 89.3 Plus
Dsim\GD11222-PA 470 GD11222-PA 111..294 56..239 289 47.8 Plus
Dsim\GD20435-PA 302 GD20435-PA 81..267 58..244 257 56.1 Plus
Dsim\GD20434-PA 264 GD20434-PA 75..259 55..239 250 49.2 Plus
Dsim\GD18951-PA 186 GD18951-PA 78..184 59..165 162 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22753-PA 219 GJ22753-PA 23..208 62..247 343 58.6 Plus
Dvir\GJ10194-PA 307 GJ10194-PA 66..284 22..242 326 43.9 Plus
Dvir\GJ24630-PA 252 GJ24630-PA 68..249 60..241 306 46.7 Plus
Dvir\GJ20562-PA 352 GJ20562-PA 56..248 47..239 303 45.6 Plus
Dvir\GJ22601-PA 233 GJ22601-PA 39..223 60..244 227 54.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14387-PA 246 GK14387-PA 1..246 1..257 474 56.8 Plus
Dwil\GK11064-PA 264 GK11064-PA 1..226 3..223 302 48.2 Plus
Dwil\GK12192-PA 270 GK12192-PA 68..259 53..244 290 47.9 Plus
Dwil\GK22021-PA 418 GK22021-PA 107..358 50..281 275 39.3 Plus
Dwil\GK10892-PA 290 GK10892-PA 78..261 56..239 184 55.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23621-PA 296 GE23621-PA 1..296 1..298 975 85.1 Plus
Dyak\GE24857-PA 260 GE24857-PA 54..247 55..247 310 56.7 Plus
Dyak\GE11823-PA 449 GE11823-PA 58..282 18..239 293 40.9 Plus
Dyak\GE10039-PA 278 GE10039-PA 15..268 9..248 244 42.1 Plus
Dyak\GE10040-PA 301 GE10040-PA 82..268 58..244 234 56.7 Plus