Clone AT11933 Report

Search the DGRC for AT11933

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:119
Well:33
Vector:pOTB7
Associated Gene/TranscriptCG12347-RA
Protein status:AT11933.pep: gold
Sequenced Size:1016

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12347 2003-01-01 Sim4 clustering to Release 3
CG12347 2004-01-31 Blastp of sequenced clone
CG12347 2008-04-29 Release 5.5 accounting
CG12347 2008-08-15 Release 5.9 accounting
CG12347 2008-12-18 5.12 accounting

Clone Sequence Records

AT11933.complete Sequence

1016 bp (1016 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011564

> AT11933.complete
CAGCACTCTCCGGGGAATTTACACGTGCACTTGCAACGCTTTCAAATTTG
CGACCAGGCTTTGCCATGGACGAGTTACTAAATCTGGGTCTCAACGGCAT
ACAGTTTGAACTGGAGGAATCTGCGGCGGATAGCGACGAGGACAGTGAAG
GAGGAGGAGCACTGGGCGGTTCTGATACCACATTGCTGTACTATTTTAGA
AGATTGTACCATGTTCTCAGTGGGAATATCTTCATGACCACCTACGTGGA
GCGCGGGCAGAGAGAATACTTTGCAGGATTCAGCAACGTGGAATTGGTGG
CTCCGTTCCAGGGTGAACGACAGAGCCAGCGGTACCGCTGGATCCACCTG
TCGCTCATCTTCCGCGCCTTCAGATCCAAGACAGAGTCCTGGTGATGATA
CCCCACCGTGTCACAGCCAAATTGAAATTCCATTTGGCATTTGTTCCGAG
TTGTTGGCCCATCTAGTTTCATTTTGCGTCCTGGCTTTCGCTTCTGACCC
ACCCCAAAGTCCACAACTCTGCCCTTTTCGGTTCCCCTGTGTAAGTGGGT
GTGTGTGTGTTTGTGTGTGACATTTTGGCAGCAGTTCAACGGAAAAACGT
TTGGCAGCACGGCCAGAAAATGATAAGCCTGGCCAGCGAGAAAGAAAAGC
GGGTGGAAACAACCCAGGAATCGGTTCACTGAGTAAAATAAAAATTGGAA
AAAGTGTAATTGAAATGCAATGCACGAGAGGAGCGAAGGGTTGCCATGGT
GGATTTCAAGGAAGCAATTCGGAAGAGACTTTCTTCAATGCCACCATAAG
GTTTCCTGCCATCAAGGCTGCGGGTTAAGGTGCCACGAAATAAACTTAAC
CATCTAGTTATGTTCTTAGCATTTAATTTATACAGCTCAGAATATAAGAA
ATGAAAAAAGAATGTACGCTCTTTAAAGGATCCTTGACTAAATGTTCAAT
TCTTGCATGTATTTTAGTATATTCTGAATATAAGAACGATATAATCTAAA
AAAAAAAAAAAAAAAA

AT11933.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12347-RA 714 CG12347-RA 20..714 1..695 3445 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13730810..13731797 1..988 4790 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17906464..17907451 1..988 4790 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17647295..17648282 1..988 4790 98.9 Plus
Blast to na_te.dros performed on 2019-03-15 23:23:06 has no hits.

AT11933.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:24:17 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13730810..13731803 1..997 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:01:33 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:57 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:07 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:48 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:47 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:50:05 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 20..714 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:57 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 20..714 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:07 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RB 1..988 1..988 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:48 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RA 20..714 1..695 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:47 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
CG12347-RB 1..988 1..988 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:17 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17906464..17907457 1..997 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:17 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17906464..17907457 1..997 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:17 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17906464..17907457 1..997 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:07 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13732186..13733179 1..997 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:12 Download gff for AT11933.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17647295..17648288 1..997 98   Plus

AT11933.hyp Sequence

Translation from 2 to 394

> AT11933.hyp
ALSGEFTRALATLSNLRPGFAMDELLNLGLNGIQFELEESAADSDEDSEG
GGALGGSDTTLLYYFRRLYHVLSGNIFMTTYVERGQREYFAGFSNVELVA
PFQGERQSQRYRWIHLSLIFRAFRSKTESW*

AT11933.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12347-PB 109 CG12347-PB 1..109 22..130 568 100 Plus
CG12347-PA 109 CG12347-PA 1..109 22..130 568 100 Plus

AT11933.pep Sequence

Translation from 65 to 394

> AT11933.pep
MDELLNLGLNGIQFELEESAADSDEDSEGGGALGGSDTTLLYYFRRLYHV
LSGNIFMTTYVERGQREYFAGFSNVELVAPFQGERQSQRYRWIHLSLIFR
AFRSKTESW*

AT11933.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16748-PA 127 GF16748-PA 1..115 1..101 255 49.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22570-PA 112 GG22570-PA 1..108 1..104 295 67.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12347-PB 109 CG12347-PB 1..109 1..109 568 100 Plus
CG12347-PA 109 CG12347-PA 1..109 1..109 568 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15268-PA 108 GM15268-PA 1..108 1..109 487 87.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19191-PA 108 GD19191-PA 1..108 1..109 485 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25502-PA 112 GE25502-PA 1..112 1..108 386 77.7 Plus