Clone AT12221 Report

Search the DGRC for AT12221

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:122
Well:21
Vector:pOTB7
Associated Gene/TranscriptCG33992-RA
Protein status:AT12221.pep: wuzgold
Sequenced Size:977

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33992 2008-04-29 Release 5.5 accounting
CG33992 2008-08-15 Release 5.9 accounting
CG33992 2008-12-18 5.12 accounting

Clone Sequence Records

AT12221.complete Sequence

977 bp (977 high quality bases) assembled on 2004-09-29

GenBank Submission: BT021467

> AT12221.complete
AACGAAGTCAAAGAAAACGACAAGGAAAAAGATGGAGGGGAAAAAAAAAC
CGGCAAAACAGAACGAAGTCAAAGAAAACGACAAGGAAAAAGGCATGGAA
AAAGGCAAGGAAAAAGGCAAGGAAAAAGGCAAGGAAAAGAAGACCAAAGA
GCCAAACTTTAGATCCTCTGAGGACCGTCCTCCAGTGCCCCAAAGTAAAG
ATACTACTCACGGGACCGAAGAAAGTCACCATGGTGACGGCGACTTCGGT
GGTCCTGATGGCGATAGAGAAAAAGGCAAGAACCAGCCTGACGGGAAAAG
CGGTATCGTAGATCAAAACCAGGGAAAAGACAAGGACAAGGGCAAAGGTA
AGGAGAAAGGCATGAATAAGAAGGGAAAGGGTAAAAAGAAACCGAAAGAT
AAGGATGAGGATAAGAATACCAAGGACAACCGGAGTGAAAAGGACTGCCC
CTGCGAGATTTGTTGTCCGCCAAAAGAAGAGGACACTCCGCTGATCAAGG
AGATGCGCCGGCGGGATCGAGAGCGCCAGGTGCGCGATTACCTCCGCCAA
ATGCGTCACCGGCAATACATGGAGTGCAAGGACCTCAAATACCCGAGCCC
ACACCATAAGTGTGATCCAATCCAGTGCAACAACCAGTTCTGTAGCAATC
CACGTATGCAAACTCATTTCGCCAGAGTCCAGGCAGTGCGAAGCTTGCAG
CAGATCCTGCAGAGAAGAAATCGACAAGGCGATGTCAAAATCTCCAAGGA
TCTGGACTCACTTTTAGCAAGGCTGTGCAATAGCCTGACAATAAGTGATG
GTCACTGCAGATGACCCCGCTTCGACTGTGTTTTGGTGATGTCTAACGAG
TCCGAGTCCGCATTTGTAACTTGTGCCTAAGTTTTTGTGTCATAACGGTA
TTGTGCTAATTTAAAGCGATCTTAATTGCGTCCTTTAAATAAACTCGAAT
CCCAAGCTGAAAAAAAAAAAAAAAAAA

AT12221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33992-RA 1090 CG33992-RA 157..1090 25..959 4635 99.8 Plus
CG33992-RA 1090 CG33992-RA 193..223 1..31 155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 327436..328369 959..25 4610 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 327428..328362 960..25 4630 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 327428..328362 960..25 4640 99.8 Minus
2L 23513712 2L 328296..328326 31..1 155 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:51:39 has no hits.

AT12221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:52:42 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 327436..327977 418..959 99 == Minus
chr2L 328075..328245 150..320 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:01:44 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 1..720 95..814 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:31:50 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 1..720 95..814 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:54:22 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG43755-RB 1261..2049 25..814 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:01 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 1..720 95..814 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:52:29 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG43755-RB 1261..2049 25..814 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:16 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 157..1090 25..959 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:31:50 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 157..1090 25..959 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:22 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG43755-RB 1400..2333 25..959 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:02 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG33992-RA 157..1090 25..959 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:29 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
CG43755-RB 1400..2333 25..959 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:42 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 327429..328362 25..959 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:42 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 327429..328362 25..959 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:42 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 327429..328362 25..959 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:22 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 327429..328362 25..959 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:36 Download gff for AT12221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 327429..328362 25..959 99   Minus

AT12221.pep Sequence

Translation from 1 to 813

> AT12221.pep
TKSKKTTRKKMEGKKKPAKQNEVKENDKEKGMEKGKEKGKEKGKEKKTKE
PNFRSSEDRPPVPQSKDTTHGTEESHHGDGDFGGPDGDREKGKNQPDGKS
GIVDQNQGKDKDKGKGKEKGMNKKGKGKKKPKDKDEDKNTKDNRSEKDCP
CEICCPPKEEDTPLIKEMRRRDRERQVRDYLRQMRHRQYMECKDLKYPSP
HHKCDPIQCNNQFCSNPRMQTHFARVQAVRSLQQILQRRNRQGDVKISKD
LDSLLARLCNSLTISDGHCR*

AT12221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15203-PA 685 GF15203-PA 577..679 158..262 221 43.9 Plus
Dana\GF24838-PA 683 GF24838-PA 567..675 151..258 197 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21641-PA 496 GG21641-PA 337..479 125..258 199 37.6 Plus
Dere\GG24655-PA 720 GG24655-PA 577..712 135..258 173 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11146-PA 712 GH11146-PA 572..702 128..259 231 37 Plus
Dgri\GH11148-PA 419 GH11148-PA 232..384 93..236 230 35.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG43755-PB 682 CG43755-PB 421..682 9..270 1412 98.5 Plus
CG31921-PA 713 CG31921-PA 421..709 2..262 303 29.8 Plus
CG31797-PA 868 CG31797-PA 569..862 8..262 269 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17853-PA 2272 GI17853-PA 532..651 147..262 248 40 Plus
Dmoj\GI17853-PA 2272 GI17853-PA 1518..1614 148..236 214 41.2 Plus
Dmoj\GI17853-PA 2272 GI17853-PA 2137..2261 142..262 171 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19274-PA 702 GL19274-PA 577..698 147..264 305 50.4 Plus
Dper\GL19273-PA 617 GL19273-PA 461..613 111..262 294 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16566-PA 783 GA16566-PA 660..779 149..264 281 48.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17019-PA 514 GM17019-PA 389..508 149..262 203 38 Plus
Dsec\GM16674-PA 706 GM16674-PA 442..702 33..262 198 30 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22963-PA 705 GD22963-PA 442..701 33..262 219 30.3 Plus
Dsim\GD21769-PA 546 GD21769-PA 421..540 149..262 208 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17348-PA 645 GJ17348-PA 523..638 148..259 210 37.1 Plus
Dvir\GJ17350-PA 724 GJ17350-PA 575..720 118..262 188 35.8 Plus
Dvir\GJ17350-PA 724 GJ17350-PA 49..162 109..219 181 35.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23886-PA 846 GK23886-PA 717..843 148..267 287 45 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12661-PA 504 GE12661-PA 312..487 69..258 221 34.2 Plus
Dyak\GE16184-PA 753 GE16184-PA 632..745 149..258 179 36.8 Plus

AT12221.hyp Sequence

Translation from 25 to 813

> AT12221.hyp
EKDGGEKKPAKQNEVKENDKEKGMEKGKEKGKEKGKEKKTKEPNFRSSED
RPPVPQSKDTTHGTEESHHGDGDFGGPDGDREKGKNQPDGKSGIVDQNQG
KDKDKGKGKEKGMNKKGKGKKKPKDKDEDKNTKDNRSEKDCPCEICCPPK
EEDTPLIKEMRRRDRERQVRDYLRQMRHRQYMECKDLKYPSPHHKCDPIQ
CNNQFCSNPRMQTHFARVQAVRSLQQILQRRNRQGDVKISKDLDSLLARL
CNSLTISDGHCR*

AT12221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43755-PB 682 CG43755-PB 421..682 1..262 1437 100 Plus
CG31921-PA 713 CG31921-PA 417..709 2..254 292 30.1 Plus
CG31797-PA 868 CG31797-PA 582..862 6..254 266 29 Plus
CG8108-PA 919 CG8108-PA 280..543 1..251 151 23.9 Plus
CG8108-PB 919 CG8108-PB 280..543 1..251 151 23.9 Plus