Clone AT12292 Report

Search the DGRC for AT12292

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:122
Well:92
Vector:pOTB7
Associated Gene/TranscriptProsbeta2R1-RA
Protein status:AT12292.pep: gold
Preliminary Size:924
Sequenced Size:1049

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18341 2002-01-01 Sim4 clustering to Release 2
CG18341 2003-01-01 Sim4 clustering to Release 3
CG18341 2003-01-22 Blastp of sequenced clone
CG18341 2008-04-29 Release 5.5 accounting
CG18341 2008-08-15 Release 5.9 accounting
CG18341 2008-12-18 5.12 accounting

Clone Sequence Records

AT12292.complete Sequence

1049 bp (1049 high quality bases) assembled on 2003-01-22

GenBank Submission: BT003647

> AT12292.complete
ACGATGCTCTTTCCTTTTTCCGCCCGAAAGGCGAATACATCCGCTGATTT
TGTTGGCTTGCGGTCCGGATTCAACTTTATAAATTGCAGGCGAAATGCCG
AGCTTTTGTCCAAGGGATATGAGCCACCGAAGGCGATCAAAACAGGCACC
TCCATTGTGGGCATCATCTACAAGGACGGCGTTATCCTGGGCGCCGACAC
TCGCGCCACCGAGGGACCCATTGTTTCCGACAAGAATTGCTCAAAAATTC
ACCACCTTCAGGATCACATATACTGTTGTGGCGCGGGCACCGCTGCCGAC
ACCGAAATGATTACCCTGACGACCAGCGCCGAGCTGGATTTGCATCGGCT
GAACACCGAACGACGGGTGCCGGTAGTCTGTGCGAGCATGATGCTTCGCA
GGACCCTCTTTCGCTACCAGGGCCACATTGGTGCCGCCTTGGTGATGGGC
GGCGTGGACACGACTGGGCCGCAGCTCTACTGCATCTATCCGTGCGGTTC
CAACGATAAGATACCCTACGCGGCCATGGGCTCCGGCACCTTGGCAGCCA
TGTCGGTGCTGGAGCACGGCTGGAAGCCCGATCTCGACCTGGAGCAGGGC
AAGCAGCTGGTCCGCGAGGCCATCTCGGCGGGTGTGTTCAACGACCTGGG
CTCCGGATCCAATATCGATCTATGCGTGATCACCGCAAAGGGAGCGGTTT
ACCTGAGAACCGATACGATTGCCAGCGAGAAGGGCGAGCGGTTGGGCAAA
TACGGCATTAAGCCCAACTCCACTATGGTCACCTCGATCTCCGTGCTGAG
TCTGCAGGTCACCGATGAGCGAATCTATGCAGTGGATGATCAACAGCCGG
GCACCAGTGGCGTTCAGTTGGATTCCCAGCAAGCGGATGAGGAACTGCCC
GAAGGATCGCAAACTAAATCACCATAGACACCCATACCATATATTTCAGT
TCGAGCAAATTAACCGTTAAATAGCCACATGGCTTTACATAAATGATAAT
GCATTCACAGAATGCAGAGATTGCCTAGAAAAAAAAAAAAAAAAAAAAA

AT12292.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2R1-RA 1165 Prosbeta2R1-RA 88..1118 1..1031 4990 98.9 Plus
Prosbeta2-RA 1061 Prosbeta2-RA 234..352 122..240 280 82.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5701826..5702581 273..1028 3780 100 Plus
chrX 22417052 chrX 5701574..5701754 92..272 875 98.9 Plus
chrX 22417052 chrX 5701424..5701515 1..92 460 100 Plus
chr3L 24539361 chr3L 14990301..14990419 122..240 280 82.4 Plus
chr3L 24539361 chr3L 14991036..14991125 592..681 195 81.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5809403..5810161 273..1031 3645 98.7 Plus
X 23542271 X 5809151..5809331 92..272 890 99.4 Plus
X 23542271 X 5809003..5809094 1..92 460 100 Plus
3L 28110227 3L 15000229..15000347 122..240 280 82.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5817501..5818259 273..1031 3645 98.6 Plus
X 23527363 X 5817249..5817429 92..272 890 99.4 Plus
X 23527363 X 5817101..5817192 1..92 460 100 Plus
3L 28103327 3L 14993329..14993447 122..240 280 82.3 Plus
Blast to na_te.dros performed on 2019-03-16 04:50:41 has no hits.

AT12292.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:51:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5701424..5701515 1..92 100 -> Plus
chrX 5701575..5701754 93..272 98 -> Plus
chrX 5701826..5702581 273..1028 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:01:51 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
CG18341-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:14 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:17 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
CG18341-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:51:28 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:09:06 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
CG18341-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:14 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 1..1028 1..1028 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 50..1077 1..1028 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:18 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
CG18341-RA 1..924 4..927 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:51:28 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2R1-RA 50..1077 1..1028 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
X 5809152..5809331 93..272 99 -> Plus
X 5809003..5809094 1..92 100 -> Plus
X 5809403..5810158 273..1028 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
X 5809152..5809331 93..272 99 -> Plus
X 5809003..5809094 1..92 100 -> Plus
X 5809403..5810158 273..1028 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
X 5809152..5809331 93..272 99 -> Plus
X 5809003..5809094 1..92 100 -> Plus
X 5809403..5810158 273..1028 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:48 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5703185..5703364 93..272 99 -> Plus
arm_X 5703036..5703127 1..92 100 -> Plus
arm_X 5703436..5704191 273..1028 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:17 Download gff for AT12292.complete
Subject Subject Range Query Range Percent Splice Strand
X 5817501..5818256 273..1028 98   Plus
X 5817101..5817192 1..92 100 -> Plus
X 5817250..5817429 93..272 99 -> Plus

AT12292.hyp Sequence

Translation from 1 to 926

> AT12292.hyp
TMLFPFSARKANTSADFVGLRSGFNFINCRRNAELLSKGYEPPKAIKTGT
SIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAAD
TEMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMG
GVDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQG
KQLVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGK
YGIKPNSTMVTSISVLSLQVTDERIYAVDDQQPGTSGVQLDSQQADEELP
EGSQTKSP*

AT12292.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2R1-PA 307 CG18341-PA 1..307 2..308 1588 100 Plus
Prosbeta2-PA 272 CG3329-PA 11..267 21..278 860 64.7 Plus
Prosbeta2R2-PA 322 CG12161-PA 22..266 22..265 516 43.3 Plus
Prosbeta1-PA 224 CG8392-PA 12..212 46..242 233 27.4 Plus
Prosbeta5-PA 282 CG12323-PA 73..258 49..233 224 32.3 Plus

AT12292.pep Sequence

Translation from 3 to 926

> AT12292.pep
MLFPFSARKANTSADFVGLRSGFNFINCRRNAELLSKGYEPPKAIKTGTS
IVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADT
EMITLTTSAELDLHRLNTERRVPVVCASMMLRRTLFRYQGHIGAALVMGG
VDTTGPQLYCIYPCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGK
QLVREAISAGVFNDLGSGSNIDLCVITAKGAVYLRTDTIASEKGERLGKY
GIKPNSTMVTSISVLSLQVTDERIYAVDDQQPGTSGVQLDSQQADEELPE
GSQTKSP*

AT12292.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21212-PA 322 GF21212-PA 1..320 1..305 1281 75 Plus
Dana\GF23798-PA 272 GF23798-PA 11..262 20..271 830 65.5 Plus
Dana\GF20928-PA 1093 GF20928-PA 22..266 21..264 492 40.8 Plus
Dana\GF19078-PA 569 GF19078-PA 13..210 45..238 264 31.8 Plus
Dana\GF13778-PA 284 GF13778-PA 73..258 48..232 229 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18789-PA 307 GG18789-PA 1..307 1..307 1428 86.3 Plus
Dere\GG15711-PA 272 GG15711-PA 11..267 20..277 840 64.3 Plus
Dere\GG11178-PA 322 GG11178-PA 22..297 21..297 507 39.6 Plus
Dere\GG22308-PA 224 GG22308-PA 12..212 45..241 239 27.4 Plus
Dere\GG20151-PA 282 GG20151-PA 73..258 48..232 231 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12772-PA 300 GH12772-PA 6..298 10..307 1117 70.1 Plus
Dgri\GH16666-PA 272 GH16666-PA 11..267 20..277 876 65.5 Plus
Dgri\GH17051-PA 299 GH17051-PA 27..244 51..264 350 35.8 Plus
Dgri\GH19825-PA 222 GH19825-PA 12..198 45..230 232 27.8 Plus
Dgri\GH20460-PA 280 GH20460-PA 73..258 48..232 219 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2R1-PA 307 CG18341-PA 1..307 1..307 1588 100 Plus
Prosbeta2-PA 272 CG3329-PA 11..267 20..277 860 64.7 Plus
Prosbeta2R2-PA 322 CG12161-PA 22..266 21..264 516 43.3 Plus
Prosbeta1-PA 224 CG8392-PA 12..212 45..241 233 27.4 Plus
Prosbeta5-PA 282 CG12323-PA 73..258 48..232 224 32.3 Plus
Prosbeta5-PB 282 CG12323-PB 73..258 48..232 224 32.3 Plus
Prosbeta5R1-PA 315 CG9868-PA 71..254 48..230 204 31 Plus
Prosbeta5R2-PB 279 CG31742-PB 71..247 48..223 185 27.7 Plus
Prosbeta5R2-PA 279 CG31742-PA 71..247 48..223 185 27.7 Plus
Prosbeta4R1-PA 215 CG17301-PA 3..204 50..247 161 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15360-PA 313 GI15360-PA 15..271 19..275 1086 77.8 Plus
Dmoj\GI11352-PA 270 GI11352-PA 11..265 20..277 897 64.7 Plus
Dmoj\GI12054-PA 322 GI12054-PA 16..234 22..239 417 38.4 Plus
Dmoj\GI20414-PA 222 GI20414-PA 12..213 45..242 228 26.7 Plus
Dmoj\GI18886-PA 279 GI18886-PA 73..258 48..232 226 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15166-PA 327 GL15166-PA 17..277 17..277 1135 79.3 Plus
Dper\GL24711-PA 272 GL24711-PA 12..267 21..277 823 63.4 Plus
Dper\GL21838-PA 312 GL21838-PA 9..292 9..304 462 35.2 Plus
Dper\GL22004-PA 298 GL22004-PA 17..269 23..274 430 37.9 Plus
Dper\GL10209-PA 225 GL10209-PA 12..213 45..242 230 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14896-PA 327 GA14896-PA 17..277 17..277 1135 79.3 Plus
Dpse\GA17382-PA 272 GA17382-PA 12..267 21..277 821 63.4 Plus
Dpse\GA26418-PA 312 GA26418-PA 9..292 9..304 474 35.9 Plus
Dpse\GA27343-PA 251 GA27343-PA 21..241 21..240 447 41.2 Plus
Dpse\GA21041-PA 225 GA21041-PA 12..213 45..242 230 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12440-PA 307 GM12440-PA 1..307 1..307 1573 95.8 Plus
Dsec\GM25498-PA 272 GM25498-PA 11..267 20..277 841 64.7 Plus
Dsec\GM10658-PA 322 GM10658-PA 22..228 21..226 499 45.9 Plus
Dsec\GM20098-PA 224 GM20098-PA 12..198 45..230 233 27.8 Plus
Dsec\GM21240-PA 282 GM21240-PA 73..258 48..232 232 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16756-PA 307 GD16756-PA 1..307 1..307 1560 94.8 Plus
Dsim\GD14518-PA 272 GD14518-PA 11..267 20..277 844 65.1 Plus
Dsim\GD19639-PA 322 GD19639-PA 22..228 21..226 498 46.4 Plus
Dsim\GD10758-PA 282 GD10758-PA 73..258 48..232 232 32.8 Plus
Dsim\GD16019-PA 206 GD16019-PA 5..194 56..241 210 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16628-PA 304 GJ16628-PA 14..301 18..307 1108 71 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 9..265 20..277 854 65.5 Plus
Dvir\GJ13326-PA 328 GJ13326-PA 16..278 22..282 452 35.7 Plus
Dvir\GJ20086-PA 222 GJ20086-PA 12..198 45..230 233 27.7 Plus
Dvir\GJ21921-PA 279 GJ21921-PA 73..258 48..232 222 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25153-PA 353 GK25153-PA 22..282 20..277 1075 75.5 Plus
Dwil\GK10550-PA 272 GK10550-PA 11..267 20..277 897 64.7 Plus
Dwil\GK18404-PA 359 GK18404-PA 22..228 21..226 485 42.5 Plus
Dwil\GK21488-PA 225 GK21488-PA 9..216 43..246 243 27.9 Plus
Dwil\GK19557-PA 362 GK19557-PA 71..254 48..230 221 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16434-PA 315 GE16434-PA 1..315 1..307 1451 88.6 Plus
Dyak\GE22042-PA 272 GE22042-PA 11..267 20..277 840 64.3 Plus
Dyak\GE25306-PA 324 GE25306-PA 22..266 21..264 511 41.6 Plus
Dyak\GE14105-PA 224 GE14105-PA 12..212 45..241 240 27.4 Plus
Dyak\Prosbeta5-PA 282 GE12841-PA 73..258 48..232 232 32.8 Plus