BDGP Sequence Production Resources |
Search the DGRC for AT12351
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 123 |
Well: | 51 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG5048-RA |
Protein status: | AT12351.pep: gold |
Preliminary Size: | 810 |
Sequenced Size: | 981 |
Gene | Date | Evidence |
---|---|---|
CG5048 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5048 | 2002-04-26 | Blastp of sequenced clone |
CG5048 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5048 | 2008-04-29 | Release 5.5 accounting |
CG5048 | 2008-08-15 | Release 5.9 accounting |
CG5048 | 2008-12-18 | 5.12 accounting |
981 bp (981 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113242
> AT12351.complete CCTCGTGCCGCTTAGCCTAGCAGTGCTCAACCTGTCTAAAAGCTAAAGCT ACAAATATATTTATAACTTGTGAAAAAGTGTGAGATCCAGTGATAGTCCG TCCATAAAGTGCCTTCAAGCCACATAGTGAAAATGTCGATCTTTGACCAT CCCGAACAGCTGAAAATGCTGCAGGGCCTTCTGAATCCCAATCAGAGAAG AGGCGGCATTGACTACAGCAGTAGCGAGGATGAGGAGGAGTCAATGGTTG TCAATAAGATGAACCCTGGAACAATTGGACGTCCTAATGGGGAGGATGGA ACCGCTAAGGGTAAGAAGAAAAAGAAGCCCAACCCTTTGTGCACTCCCTT GGTGGAGGAAGAGAAAAAACAGCCCGAGAGTCTGGAAGAATGGCAAGATC AGCAGGAGAAGGAAGACATGGATATACTTGAATCGCGGAAGACTCCCGAG TATACGATGACCTATCGCCAAGCAGTGGGCACTGAGGATGTTTTCTTGCA GATGGGCAATCGCACTGGATCCTCGGCCAGCTGTGAGGACCTCATTTTGG AGGTTTCCCTGCCGGACGAGGAAATGACTGCTGACAAAATGTCGCTCAGC TTGCAGGAAACTGAATTGGATTTGGGTACATGTTTGTACCGCTTACGATT ACCGCTTCCCCATCCCGTCAATGTTGATCGTTGTCATGCAAAATACGATA GTGAGCTGAAGAAACTACGTCTCACTCTGCGCCTGCAGCGCGAACTAGAC TATGTTAATTTTTAAAAACGGACTAAATAATTAATTTTTAATTGCTTTCA TATTACACAATAGGAACACACAGTATAAATTATAGTCCCAAAATTTTAGC GTGTCTGAAAAATTTGTTTGCATCGTTTGCTTAGATACAAGATGTATGTC TTTTAATATTATATGGTCATTTACTTTGTGTATCAGGAATTAAAACATTC TTAACCACCAACAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5048-RA | 1105 | CG5048-RA | 135..1085 | 10..960 | 4665 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14675504..14675966 | 500..962 | 2255 | 99.1 | Plus |
chr3L | 24539361 | chr3L | 14674903..14675155 | 10..262 | 1265 | 100 | Plus |
chr3L | 24539361 | chr3L | 14675208..14675446 | 263..501 | 1180 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14685380..14685840 | 500..960 | 2230 | 98.9 | Plus |
3L | 28110227 | 3L | 14684779..14685031 | 10..262 | 1265 | 100 | Plus |
3L | 28110227 | 3L | 14685084..14685322 | 263..501 | 1180 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14678480..14678940 | 500..960 | 2230 | 98.9 | Plus |
3L | 28103327 | 3L | 14677879..14678131 | 10..262 | 1265 | 100 | Plus |
3L | 28103327 | 3L | 14678184..14678422 | 263..501 | 1180 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
jockey2 | 3428 | jockey2 JOCKEY2 3428bp | 1949..2020 | 373..445 | 119 | 64.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14675506..14675966 | 502..962 | 99 | Plus | |
chr3L | 14674903..14675155 | 10..262 | 100 | -> | Plus |
chr3L | 14675208..14675446 | 263..501 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 1..633 | 133..765 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 1..633 | 133..765 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 1..633 | 133..765 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 1..633 | 133..765 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 1..633 | 133..765 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 55..1007 | 10..962 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 55..1007 | 10..962 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 12..964 | 10..962 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 55..1007 | 10..962 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5048-RA | 12..964 | 10..962 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14685382..14685842 | 502..962 | 98 | Plus | |
3L | 14684779..14685031 | 10..262 | 100 | -> | Plus |
3L | 14685084..14685322 | 263..501 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14685382..14685842 | 502..962 | 98 | Plus | |
3L | 14684779..14685031 | 10..262 | 100 | -> | Plus |
3L | 14685084..14685322 | 263..501 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14685382..14685842 | 502..962 | 98 | Plus | |
3L | 14684779..14685031 | 10..262 | 100 | -> | Plus |
3L | 14685084..14685322 | 263..501 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14677879..14678131 | 10..262 | 100 | -> | Plus |
arm_3L | 14678184..14678422 | 263..501 | 99 | -> | Plus |
arm_3L | 14678482..14678942 | 502..962 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14677879..14678131 | 10..262 | 100 | -> | Plus |
3L | 14678184..14678422 | 263..501 | 99 | -> | Plus |
3L | 14678482..14678942 | 502..962 | 98 | Plus |
Translation from 132 to 764
> AT12351.pep MSIFDHPEQLKMLQGLLNPNQRRGGIDYSSSEDEEESMVVNKMNPGTIGR PNGEDGTAKGKKKKKPNPLCTPLVEEEKKQPESLEEWQDQQEKEDMDILE SRKTPEYTMTYRQAVGTEDVFLQMGNRTGSSASCEDLILEVSLPDEEMTA DKMSLSLQETELDLGTCLYRLRLPLPHPVNVDRCHAKYDSELKKLRLTLR LQRELDYVNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24613-PA | 211 | GF24613-PA | 1..211 | 1..210 | 818 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15691-PA | 209 | GG15691-PA | 1..209 | 1..210 | 871 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14755-PA | 210 | GH14755-PA | 1..210 | 1..210 | 656 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5048-PA | 210 | CG5048-PA | 1..210 | 1..210 | 1099 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11496-PA | 210 | GI11496-PA | 1..210 | 1..210 | 663 | 68.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24527-PA | 214 | GL24527-PA | 1..214 | 1..210 | 630 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23617-PA | 214 | GA23617-PA | 1..214 | 1..210 | 630 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25474-PA | 210 | GM25474-PA | 1..210 | 1..210 | 1085 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14497-PA | 210 | GD14497-PA | 1..210 | 1..210 | 1089 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13691-PA | 213 | GJ13691-PA | 1..213 | 1..210 | 656 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12880-PA | 372 | GK12880-PA | 1..204 | 1..207 | 705 | 71.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22022-PA | 210 | GE22022-PA | 1..210 | 1..210 | 868 | 91.4 | Plus |
Translation from 132 to 764
> AT12351.hyp MSIFDHPEQLKMLQGLLNPNQRRGGIDYSSSEDEEESMVVNKMNPGTIGR PNGEDGTAKGKKKKKPNPLCTPLVEEEKKQPESLEEWQDQQEKEDMDILE SRKTPEYTMTYRQAVGTEDVFLQMGNRTGSSASCEDLILEVSLPDEEMTA DKMSLSLQETELDLGTCLYRLRLPLPHPVNVDRCHAKYDSELKKLRLTLR LQRELDYVNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5048-PA | 210 | CG5048-PA | 1..210 | 1..210 | 1099 | 100 | Plus |