Clone AT12489 Report

Search the DGRC for AT12489

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:124
Well:89
Vector:pOTB7
Associated Gene/TranscriptCG5180-RB
Protein status:AT12489.pep: gold
Preliminary Size:1334
Sequenced Size:1543

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5180 2002-01-01 Sim4 clustering to Release 2
CG5180 2002-02-22 Blastp of sequenced clone
CG5180 2003-01-01 Sim4 clustering to Release 3
CG5180 2008-04-29 Release 5.5 accounting
CG5180 2008-08-15 Release 5.9 accounting
CG5180 2008-12-18 5.12 accounting

Clone Sequence Records

AT12489.complete Sequence

1543 bp (1543 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089316

> AT12489.complete
GGCATACAAGTTCGTTTAAACAAAATATTAAACATAAATAAACATTAAAA
TATATTATTAAACAAAATATATTCTTGACTTGCAATAGATATGCCGTATC
ACTCATAAATGCAATACAAAGGGCTCGATACCATCTCGACCGCGATGATT
TGTTTGGGTTGGCAACGCCCCGACGTTTGTGGCGCAGCCAACTTCACGCG
AGACGCAGCGAAAACAAAAAATACTAAGCTGAAGTTAATTGAGAAAACCC
CAAATAAAACGCGAGTGAAAGGGACCATGAACTTAGACCTGCGTTCGTAC
TCACGCCACTGGCTCACGGAGTTTATCGAGCAGTACCAAGAGGAGGAGTG
CCTCTGGCAGCCCAAGCACAACGACTACAGCAATCACACAGCCCGTAACA
AGTCCTACGATCGCCTGGTGGAGAAGCTAAAAGAAGTGGAGCCCAATCCG
GACAGGGCGATGGTAGTAAGGAAAATTAACTCACTGCGGTCCGCTTTTCG
GCGGGAATTCCGCAAGACGAGTACCAAAGGCGACTACGCAACGCGTTTGT
GGTACTACGACAAGCTGCTTTTCATCGCTGACCACAAGCCCAAGCGCCAC
GAACTCGGCTCCAAGCCCAAGAGAGAACTCCATATCAGCTTCGACGACGA
GGAGTCAATGGAGTTCGAGGACGACTCACATCACACGGGCACTCAGTCTC
AGCACATGGAGTCCATAATACCCACGTCCCCGGACGATGTGGAAGAAGTC
GCGGCGACGGCCAACAATGTGGTCGTCAGCAGTCAGGGCGCCACTCTGAG
CACCATTTCGGTGACGCCCGCGGAATGTGTGACCCTTGTCAAGAGCGAGG
AGCACCAGGCGGCCGAAGCAGCGGCAGCCGCAGCCCAAGCACACCAGCAA
ATGGTAGCCCATGCAGCAGCCCAGACCTCCATTGCGGCGGCGGCGGCTCA
GGGACATGCCGTGAAGGTCTTAGAGATCACCTCCCTAGACTCCAACTCCC
AGCGCGAGATACAACAAGCGGTCAATCATCTGGAGCACCACCAGCAGCAG
CTCCACCTGCAGCAGACGAATGGCCAACATCAGGGCGTTCCCACCATCCA
GATAGGCCGCGATCACTATCAGCCATTGTTTGGCAATGCCGGCACCACTG
CCTATACCACCACAGCGGCTACGAGCACATCGCACCGGCAAGACGACGAG
TACGATGCCATTGGCGTGAATGTGGCGAGCAAACTGCGCTCCATCAACCC
GACGCAGCGGATCGTGGCCGAGAAACTGATCAGCGACGTTCTATTCAACG
CACAGCTGGGCAACCTCACCGTTCACTCGGCCCTCACGCAGTAATCTCTC
TTGTCCCCCTAGACTAAGTATGTGTAGTCTCTGGCTTTATATCTCCATTT
TGTCTGTGTCCCAACCTGCAGCCCGGCCAACATGTGTCGCCCGGGCAGCA
GCCGATTGTACCATACAGTTTGCATGTAGTTTTAATTATTCTATACAATA
AATAGATTGTATGTCTTAAAAAAAAAAAAAAAAAAAAAAAAAA

AT12489.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5180-RB 1598 CG5180-RB 80..1598 1..1519 7595 100 Plus
CG5180-RA 1602 CG5180-RA 80..1598 1..1519 7595 100 Plus
CG15922-RA 566 CG15922-RA 511..566 1519..1464 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16382562..16383111 469..1018 2750 100 Plus
chr3R 27901430 chr3R 16383175..16383674 1018..1517 2500 100 Plus
chr3R 27901430 chr3R 16382157..16382506 122..471 1750 100 Plus
chr3R 27901430 chr3R 16381844..16381966 1..123 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20558648..20559197 469..1018 2750 100 Plus
3R 32079331 3R 20559261..20559762 1018..1519 2510 100 Plus
3R 32079331 3R 20558243..20558592 122..471 1750 100 Plus
3R 32079331 3R 20557930..20558052 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20299479..20300028 469..1018 2750 100 Plus
3R 31820162 3R 20300092..20300593 1018..1519 2510 100 Plus
3R 31820162 3R 20299074..20299423 122..471 1750 100 Plus
3R 31820162 3R 20298761..20298883 1..123 615 100 Plus
Blast to na_te.dros performed 2019-03-15 17:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1490..1591 972..1078 118 59.8 Plus

AT12489.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:46:17 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16381917..16381965 74..122 100 -> Plus
chr3R 16382158..16382505 123..470 100 -> Plus
chr3R 16382564..16383110 471..1017 100 -> Plus
chr3R 16383175..16383674 1018..1517 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:14 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RA 1..1236 109..1344 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:52 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RA 1..1236 109..1344 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:30 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RB 1..1068 277..1344 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:56 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RA 1..1236 109..1344 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:13 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RB 1..1068 277..1344 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:41 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RB 1..1517 1..1517 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:52 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RB 1..1517 1..1517 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:30 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RC 1..1517 1..1517 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:56 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RB 1..1517 1..1517 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:13 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
CG5180-RC 1..1517 1..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:17 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20557930..20558051 1..122 100 -> Plus
3R 20558244..20558591 123..470 100 -> Plus
3R 20558650..20559196 471..1017 100 -> Plus
3R 20559261..20559760 1018..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:17 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20557930..20558051 1..122 100 -> Plus
3R 20558244..20558591 123..470 100 -> Plus
3R 20558650..20559196 471..1017 100 -> Plus
3R 20559261..20559760 1018..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:17 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20557930..20558051 1..122 100 -> Plus
3R 20558244..20558591 123..470 100 -> Plus
3R 20558650..20559196 471..1017 100 -> Plus
3R 20559261..20559760 1018..1517 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:30 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16383652..16383773 1..122 100 -> Plus
arm_3R 16383966..16384313 123..470 100 -> Plus
arm_3R 16384372..16384918 471..1017 100 -> Plus
arm_3R 16384983..16385482 1018..1517 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:19 Download gff for AT12489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20299075..20299422 123..470 100 -> Plus
3R 20299481..20300027 471..1017 100 -> Plus
3R 20300092..20300591 1018..1517 100   Plus
3R 20298761..20298882 1..122 100 -> Plus

AT12489.pep Sequence

Translation from 108 to 1343

> AT12489.pep
MQYKGLDTISTAMICLGWQRPDVCGAANFTRDAAKTKNTKLKLIEKTPNK
TRVKGTMNLDLRSYSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSY
DRLVEKLKEVEPNPDRAMVVRKINSLRSAFRREFRKTSTKGDYATRLWYY
DKLLFIADHKPKRHELGSKPKRELHISFDDEESMEFEDDSHHTGTQSQHM
ESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTPAECVTLVKSEEHQ
AAEAAAAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQRE
IQQAVNHLEHHQQQLHLQQTNGQHQGVPTIQIGRDHYQPLFGNAGTTAYT
TTAATSTSHRQDDEYDAIGVNVASKLRSINPTQRIVAEKLISDVLFNAQL
GNLTVHSALTQ*

AT12489.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23031-PA 351 GF23031-PA 1..351 57..411 1355 81.2 Plus
Dana\GF12893-PA 370 GF12893-PA 3..356 68..409 209 28.1 Plus
Dana\GF25258-PA 238 GF25258-PA 1..186 61..220 197 30.1 Plus
Dana\GF21386-PA 511 GF21386-PA 179..264 72..156 157 34.9 Plus
Dana\GF24078-PA 468 GF24078-PA 14..111 66..156 151 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23945-PA 355 GG23945-PA 1..355 57..411 1451 94.9 Plus
Dere\GG22924-PA 366 GG22924-PA 3..349 68..406 185 24.5 Plus
Dere\GG14648-PA 288 GG14648-PA 14..111 66..156 151 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14156-PA 377 GH14156-PA 8..377 60..411 1279 75.3 Plus
Dgri\GH16644-PA 261 GH16644-PA 1..112 61..168 194 36.6 Plus
Dgri\GH16042-PA 308 GH16042-PA 13..118 66..164 172 33 Plus
Dgri\GH20173-PA 360 GH20173-PA 3..344 68..411 165 21.4 Plus
Dgri\GH12134-PA 398 GH12134-PA 14..109 71..158 153 32.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5180-PC 355 CG5180-PC 1..355 57..411 1829 100 Plus
CG5180-PB 355 CG5180-PB 1..355 57..411 1829 100 Plus
CG3163-PA 368 CG3163-PA 3..351 68..406 215 22.9 Plus
CG3386-PD 288 CG3386-PD 14..147 66..188 161 29.1 Plus
CG3386-PC 288 CG3386-PC 14..147 66..188 161 29.1 Plus
CG3386-PB 288 CG3386-PB 14..147 66..188 161 29.1 Plus
CG3386-PA 288 CG3386-PA 14..147 66..188 161 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22237-PA 359 GI22237-PA 4..359 55..411 1324 74.2 Plus
Dmoj\GI11601-PA 248 GI11601-PA 1..99 61..156 216 41.4 Plus
Dmoj\GI12053-PA 234 GI12053-PA 12..152 71..207 172 29.3 Plus
Dmoj\GI12306-PA 295 GI12306-PA 13..110 66..156 158 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13562-PA 347 GL13562-PA 1..347 57..411 1421 81.7 Plus
Dper\GL13143-PA 543 GL13143-PA 187..533 67..410 197 22.7 Plus
Dper\GL20841-PA 792 GL20841-PA 508..605 66..156 169 35.7 Plus
Dper\GL20840-PA 298 GL20840-PA 14..111 66..156 165 35.7 Plus
Dper\GL13143-PA 543 GL13143-PA 45..144 69..171 155 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18714-PA 347 GA18714-PA 1..347 57..411 1421 81.7 Plus
Dpse\GA23414-PA 292 GA23414-PA 1..100 61..156 192 39 Plus
Dpse\GA17842-PA 543 GA17842-PA 187..533 67..410 190 24.1 Plus
Dpse\GA17418-PA 298 GA17418-PA 14..111 66..156 165 35.7 Plus
Dpse\GA17842-PA 543 GA17842-PA 45..144 69..171 162 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23117-PA 411 GM23117-PA 1..411 1..411 1752 93.9 Plus
Dsec\GM18291-PA 368 GM18291-PA 3..354 68..409 187 24.4 Plus
Dsec\GM14263-PA 288 GM14263-PA 14..147 66..188 153 29.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19356-PA 411 GD19356-PA 1..411 1..411 1777 95.1 Plus
Dsim\GD24799-PA 148 GD24799-PA 16..104 69..156 147 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23041-PA 358 GJ23041-PA 8..358 60..411 1307 79.8 Plus
Dvir\GJ11280-PA 271 GJ11280-PA 1..99 61..156 211 40.4 Plus
Dvir\GJ13242-PA 295 GJ13242-PA 13..110 66..156 171 36.7 Plus
Dvir\GJ20438-PA 358 GJ20438-PA 3..342 68..411 171 23.1 Plus
Dvir\GJ13325-PA 258 GJ13325-PA 10..105 68..156 164 34 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22452-PA 343 GK22452-PA 2..343 57..411 1313 76.9 Plus
Dwil\GK16686-PA 366 GK16686-PA 16..126 66..163 160 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25667-PA 355 GE25667-PA 1..355 57..411 1513 95.8 Plus
Dyak\GE14362-PA 367 GE14362-PA 3..350 68..406 181 24.7 Plus
Dyak\GE21008-PA 288 GE21008-PA 14..111 66..156 151 33.7 Plus

AT12489.hyp Sequence

Translation from 108 to 1343

> AT12489.hyp
MQYKGLDTISTAMICLGWQRPDVCGAANFTRDAAKTKNTKLKLIEKTPNK
TRVKGTMNLDLRSYSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSY
DRLVEKLKEVEPNPDRAMVVRKINSLRSAFRREFRKTSTKGDYATRLWYY
DKLLFIADHKPKRHELGSKPKRELHISFDDEESMEFEDDSHHTGTQSQHM
ESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTPAECVTLVKSEEHQ
AAEAAAAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQRE
IQQAVNHLEHHQQQLHLQQTNGQHQGVPTIQIGRDHYQPLFGNAGTTAYT
TTAATSTSHRQDDEYDAIGVNVASKLRSINPTQRIVAEKLISDVLFNAQL
GNLTVHSALTQ*

AT12489.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5180-PC 355 CG5180-PC 1..355 57..411 1829 100 Plus
CG5180-PB 355 CG5180-PB 1..355 57..411 1829 100 Plus
CG3163-PA 368 CG3163-PA 3..351 68..406 215 22.9 Plus
CG3386-PD 288 CG3386-PD 14..147 66..188 161 29.1 Plus
CG3386-PC 288 CG3386-PC 14..147 66..188 161 29.1 Plus