Clone AT12494 Report

Search the DGRC for AT12494

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:124
Well:94
Vector:pOTB7
Associated Gene/TranscriptCG9306-RA
Protein status:AT12494.pep: gold
Preliminary Size:619
Sequenced Size:678

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9306 2001-12-16 Blastp of sequenced clone
CG9306 2002-01-01 Sim4 clustering to Release 2
CG9306 2003-01-01 Sim4 clustering to Release 3
CG9306 2008-04-29 Release 5.5 accounting
CG9306 2008-08-15 Release 5.9 accounting
CG9306 2008-12-18 5.12 accounting

Clone Sequence Records

AT12494.complete Sequence

678 bp (678 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070784

> AT12494.complete
GTCGTTCTCTAAAATTATTTTTCGCTTCGCAACACATATTTTCAGGCGCA
GGGCTTTAGAGCACTGGACTTTTGACAGCTGTTGTTGTTGTTGCCTCGGC
TGCGGTAGCAAATTAATACAATTTAACCAATATAGTAAAAAACGATGGCC
CAAGTTCCCTTGGCAATCGTCTCGCACAAGCGCCAGGTGTGCAGCCTGTA
CAAGCGAGCACTGCGCAACTTAGAGTCGTGGTACGACCGACGCAATGTCT
ACCGCTACCGCGCTGTGCAGCTGCGTGCTCGCTTCGACGAAAACCGCTCC
AAAGATCTGGGCGAGGGCATCCGCCTCCTAGCCTGTGGACAAAGGGAGCT
TTTCGAGACAAGGCATTTCCAGCCCCGAAACTTTGCCAACAGTGCCGGTG
GCTGTGCTTTCGAACGAGAGGTGATTCCGCCCGACTGGGTCCTGGACTAC
TGGCATCCCCTGGAGAAGGCCCAGTACCCCGAGTACTTTGCCAAGCGGGA
GCAGCGCAAGAAGGAGTTTGTGACCTGGTGGGAGAAGCAGTACGGCAAGC
CCGACCCCAAGGACCTGGGACACCACTAATCTTAGAGTACCGTAATCAAA
TCACATCCAATCTTTGTCTTTAAAAGTAAATCTATTGGAACTCACATTAT
GTGCTATTATAAAAAAAAAAAAAAAAAA

AT12494.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9306-RA 772 CG9306-RA 30..690 3..663 3305 100 Plus
CG9306.a 716 CG9306.a 230..651 242..663 2110 100 Plus
CG9306.a 716 CG9306.a 3..230 3..230 1140 100 Plus
CG31855-RA 1136 CG31855-RA 1077..1136 663..604 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13368961..13369238 660..383 1390 100 Minus
chr2L 23010047 chr2L 13369516..13369757 242..1 1210 100 Minus
chr2L 23010047 chr2L 13369298..13369438 382..242 705 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13370284..13370564 663..383 1405 100 Minus
2L 23513712 2L 13370842..13371081 242..3 1200 100 Minus
2L 23513712 2L 13370624..13370764 382..242 705 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13370284..13370564 663..383 1405 100 Minus
2L 23513712 2L 13370842..13371081 242..3 1200 100 Minus
2L 23513712 2L 13370624..13370764 382..242 705 100 Minus
Blast to na_te.dros performed 2019-03-15 23:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6446..6482 108..72 113 78.4 Minus

AT12494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:24:38 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13369516..13369757 1..242 100   Minus
chr2L 13368961..13369238 383..660 100 <- Minus
chr2L 13369298..13369437 243..382 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:16 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..435 145..579 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:58 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..435 145..579 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:35 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..435 145..579 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:30 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..435 145..579 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:48 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..435 145..579 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:30 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..660 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:58 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..660 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:35 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RB 28..687 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:30 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RA 1..660 1..660 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:48 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
CG9306-RB 28..687 1..660 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:38 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13370624..13370763 243..382 100 <- Minus
2L 13370842..13371083 1..242 99   Minus
2L 13370287..13370564 383..660 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:38 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13370624..13370763 243..382 100 <- Minus
2L 13370842..13371083 1..242 99   Minus
2L 13370287..13370564 383..660 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:38 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13370624..13370763 243..382 100 <- Minus
2L 13370842..13371083 1..242 99   Minus
2L 13370287..13370564 383..660 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:35 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13370287..13370564 383..660 100 <- Minus
arm_2L 13370624..13370763 243..382 100 <- Minus
arm_2L 13370842..13371083 1..242 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:14 Download gff for AT12494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13370287..13370564 383..660 100 <- Minus
2L 13370624..13370763 243..382 100 <- Minus
2L 13370842..13371083 1..242 99   Minus

AT12494.pep Sequence

Translation from 144 to 578

> AT12494.pep
MAQVPLAIVSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDEN
RSKDLGEGIRLLACGQRELFETRHFQPRNFANSAGGCAFEREVIPPDWVL
DYWHPLEKAQYPEYFAKREQRKKEFVTWWEKQYGKPDPKDLGHH*

AT12494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21668-PA 144 GF21668-PA 1..144 1..144 742 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10207-PA 144 GG10207-PA 1..144 1..144 745 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13455-PA 144 GH13455-PA 1..144 1..144 721 90.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B22-PB 144 CG9306-PB 1..144 1..144 796 100 Plus
ND-B22-PA 144 CG9306-PA 1..144 1..144 796 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14070-PA 144 GI14070-PA 1..144 1..144 700 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25714-PA 144 GL25714-PA 1..144 1..144 702 87.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25406-PA 144 GA25406-PA 1..144 1..144 706 88.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25609-PA 144 GM25609-PA 1..144 1..144 752 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22067-PA 144 GD22067-PA 1..144 1..144 752 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18263-PA 144 GJ18263-PA 1..144 1..144 723 90.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14843-PA 144 GK14843-PA 1..144 1..144 748 95.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11677-PA 144 GE11677-PA 1..144 1..144 756 97.2 Plus

AT12494.hyp Sequence

Translation from 144 to 578

> AT12494.hyp
MAQVPLAIVSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDEN
RSKDLGEGIRLLACGQRELFETRHFQPRNFANSAGGCAFEREVIPPDWVL
DYWHPLEKAQYPEYFAKREQRKKEFVTWWEKQYGKPDPKDLGHH*

AT12494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9306-PB 144 CG9306-PB 1..144 1..144 796 100 Plus
CG9306-PA 144 CG9306-PA 1..144 1..144 796 100 Plus