Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT12577.complete Sequence
1012 bp (1012 high quality bases) assembled on 2002-04-19
GenBank Submission: AY113245
> AT12577.complete
CATTGGAGCACAAAAATTTGTTTTGTTGCATTAGATACAGTCAGACCCCT
TGCTAAATTTTAAGTGATTTTAAATCAATAATCGGTTCACCATGAGTATG
ATACAAGAAGAGACCAAGGCCAGCGTAATCAGCGTGGTAAAGCCGCCACC
GAGTTGGGTGGAATGGTGCGAGCGGAATGCCAAGCCGATCGAACGTCGGC
TCATCAAGGAGAGGCGCTATCTAACCAGATGGCAAATTCCCGGACCGATG
AAAAAGGCACAGTGGAGGGAGTTCTACGAGTGGGCAGCCTCCAGAGCCAT
GCCAAAGGAACTACCGGTGCCGGTCAAACAGCCCATACCCTGTGTTGACA
AGTTCTTGCCATGCGCCAGAAAACCACGCGCAATCGATCCGGACGAATTT
CAGGAGAAGGTCGCCAAGTTGGCCACGCCACTGGAACGGAAAATGACGCC
GAAGCATCAGTACATCTATCCGGTCCAACCGTACTCCCCAATAATTGTCT
GGGGTCAGCCGCCACTCCATGACAAAGGACGACCCTTTAAGCCCCCTCAA
AAACCCTGCTGCTTCTTCAATGCCGACATCGAGGACAAATGGTGGGCCGA
ACTGCGCTTTCCCATCCGCAAGGCTGCTCTCAAAGCCAGGATAACTCCGC
GCATCCTTAGCCTGTCGAAACCAAAGATCACGCCTCAGTTCCCACCGCAT
TGCTATCATCCGGAGCATATATATGACGTGCTTAATGTCAAACCGCCACG
GAGGAAGAAGTTTACTCCCCAGGGATGGCGTCTCCACCAGATCAGATTGC
TATATCTTTCGAAGCCTGTGTCCCGGCCCGAATACGAGTATTTTTATATG
TAATATCGTGTCATATAGCGCCCATAATGTTTTTGATCTAAAGTTTGTGT
TTGATGTAATCTGTTTTCAAAATTTAATATTTTCAAAATTAATATTTTTT
GAATGAAAACAAATATCTGAAGAAGACTGAATCTTCCATACTGAAAAAAA
AAAAAAAAAAAA
AT12577.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:15:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3581-RA | 993 | CG3581-RA | 1..993 | 1..993 | 4965 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:16:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 15197669..15198661 | 993..1 | 4965 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 19373756..19374749 | 994..1 | 4970 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 19114587..19115580 | 994..1 | 4970 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 15:16:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 1430..1507 | 957..879 | 141 | 67.9 | Minus |
P-element | 2907 | P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). | 2484..2537 | 965..914 | 130 | 76.4 | Minus |
rover | 7318 | rover ROVER 7318bp | 3975..4061 | 939..855 | 114 | 62.1 | Minus |
297 | 6995 | 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). | 593..703 | 949..839 | 113 | 58 | Minus |
AT12577.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:17:39 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 15197669..15198661 | 1..993 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:26 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..762 | 92..853 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:06:02 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..762 | 92..853 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:10:10 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..762 | 92..853 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:55:32 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..762 | 92..853 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:48 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..762 | 92..853 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:43:57 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..993 | 1..993 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:06:02 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..993 | 1..993 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:10:10 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 41..1033 | 1..993 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:55:32 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 1..993 | 1..993 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:48 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3581-RA | 41..1033 | 1..993 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19373757..19374749 | 1..993 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19373757..19374749 | 1..993 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19373757..19374749 | 1..993 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:10:10 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 15199479..15200471 | 1..993 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:27:50 Download gff for
AT12577.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19114588..19115580 | 1..993 | 100 | | Minus |
AT12577.pep Sequence
Translation from 91 to 852
> AT12577.pep
MSMIQEETKASVISVVKPPPSWVEWCERNAKPIERRLIKERRYLTRWQIP
GPMKKAQWREFYEWAASRAMPKELPVPVKQPIPCVDKFLPCARKPRAIDP
DEFQEKVAKLATPLERKMTPKHQYIYPVQPYSPIIVWGQPPLHDKGRPFK
PPQKPCCFFNADIEDKWWAELRFPIRKAALKARITPRILSLSKPKITPQF
PPHCYHPEHIYDVLNVKPPRRKKFTPQGWRLHQIRLLYLSKPVSRPEYEY
FYM*
AT12577.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:11:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18464-PA | 254 | GF18464-PA | 1..254 | 1..253 | 919 | 69.7 | Plus |
Dana\GF19945-PA | 265 | GF19945-PA | 21..262 | 7..252 | 631 | 53.8 | Plus |
Dana\GF18463-PA | 237 | GF18463-PA | 10..229 | 21..245 | 264 | 36.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:11:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16030-PA | 253 | GG16030-PA | 1..253 | 1..253 | 1172 | 94.9 | Plus |
Dere\GG16019-PA | 278 | GG16019-PA | 28..275 | 2..252 | 548 | 49.8 | Plus |
Dere\GG16008-PA | 236 | GG16008-PA | 10..226 | 21..245 | 272 | 34.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3581-PA | 253 | CG3581-PA | 1..253 | 1..253 | 1410 | 100 | Plus |
CG31404-PA | 274 | CG31404-PA | 30..274 | 4..251 | 605 | 50.8 | Plus |
CG31245-PA | 237 | CG31245-PA | 10..227 | 21..245 | 279 | 33.5 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:11:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11969-PA | 259 | GL11969-PA | 24..259 | 19..253 | 642 | 59.3 | Plus |
Dper\GL12645-PA | 256 | GL12645-PA | 27..256 | 17..253 | 542 | 48.1 | Plus |
Dper\GL11968-PA | 250 | GL11968-PA | 12..238 | 24..245 | 205 | 31.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:11:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA17535-PB | 259 | GA17535-PB | 24..259 | 19..253 | 642 | 59.3 | Plus |
Dpse\GA27579-PA | 256 | GA27579-PA | 27..256 | 17..253 | 539 | 47.7 | Plus |
Dpse\GA16119-PB | 250 | GA16119-PB | 12..238 | 24..245 | 190 | 31 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:11:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26912-PA | 253 | GM26912-PA | 1..253 | 1..253 | 1294 | 98.4 | Plus |
Dsec\GM26911-PA | 207 | GM26911-PA | 29..182 | 3..158 | 304 | 46.8 | Plus |
Dsec\GM26910-PA | 236 | GM26910-PA | 10..226 | 21..245 | 245 | 33.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:11:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20118-PA | 253 | GD20118-PA | 1..253 | 1..253 | 1292 | 98.4 | Plus |
Dsim\GD20117-PA | 196 | GD20117-PA | 1..196 | 53..251 | 441 | 51.2 | Plus |
Dsim\GD20116-PA | 236 | GD20116-PA | 10..226 | 21..245 | 249 | 34.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:11:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13479-PA | 1892 | GK13479-PA | 1502..1705 | 20..222 | 561 | 54.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:11:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25133-PA | 253 | GE25133-PA | 1..253 | 1..253 | 1156 | 92.9 | Plus |
Dyak\GE25132-PA | 278 | GE25132-PA | 41..275 | 15..252 | 538 | 50.8 | Plus |
Dyak\GE25131-PA | 236 | GE25131-PA | 10..226 | 21..245 | 269 | 33.3 | Plus |
AT12577.hyp Sequence
Translation from 91 to 852
> AT12577.hyp
MSMIQEETKASVISVVKPPPSWVEWCERNAKPIERRLIKERRYLTRWQIP
GPMKKAQWREFYEWAASRAMPKELPVPVKQPIPCVDKFLPCARKPRAIDP
DEFQEKVAKLATPLERKMTPKHQYIYPVQPYSPIIVWGQPPLHDKGRPFK
PPQKPCCFFNADIEDKWWAELRFPIRKAALKARITPRILSLSKPKITPQF
PPHCYHPEHIYDVLNVKPPRRKKFTPQGWRLHQIRLLYLSKPVSRPEYEY
FYM*
AT12577.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:06:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3581-PA | 253 | CG3581-PA | 1..253 | 1..253 | 1410 | 100 | Plus |
CG31404-PA | 274 | CG31404-PA | 30..274 | 4..251 | 605 | 50.8 | Plus |
CG31245-PA | 237 | CG31245-PA | 10..227 | 21..245 | 279 | 33.5 | Plus |