Clone AT12577 Report

Search the DGRC for AT12577

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:125
Well:77
Vector:pOTB7
Associated Gene/TranscriptCG3581-RA
Protein status:AT12577.pep: gold
Preliminary Size:826
Sequenced Size:1012

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3581 2002-01-01 Sim4 clustering to Release 2
CG3581 2002-04-19 Blastp of sequenced clone
CG3581 2003-01-01 Sim4 clustering to Release 3
CG3581 2008-04-29 Release 5.5 accounting
CG3581 2008-08-15 Release 5.9 accounting
CG3581 2008-12-18 5.12 accounting

Clone Sequence Records

AT12577.complete Sequence

1012 bp (1012 high quality bases) assembled on 2002-04-19

GenBank Submission: AY113245

> AT12577.complete
CATTGGAGCACAAAAATTTGTTTTGTTGCATTAGATACAGTCAGACCCCT
TGCTAAATTTTAAGTGATTTTAAATCAATAATCGGTTCACCATGAGTATG
ATACAAGAAGAGACCAAGGCCAGCGTAATCAGCGTGGTAAAGCCGCCACC
GAGTTGGGTGGAATGGTGCGAGCGGAATGCCAAGCCGATCGAACGTCGGC
TCATCAAGGAGAGGCGCTATCTAACCAGATGGCAAATTCCCGGACCGATG
AAAAAGGCACAGTGGAGGGAGTTCTACGAGTGGGCAGCCTCCAGAGCCAT
GCCAAAGGAACTACCGGTGCCGGTCAAACAGCCCATACCCTGTGTTGACA
AGTTCTTGCCATGCGCCAGAAAACCACGCGCAATCGATCCGGACGAATTT
CAGGAGAAGGTCGCCAAGTTGGCCACGCCACTGGAACGGAAAATGACGCC
GAAGCATCAGTACATCTATCCGGTCCAACCGTACTCCCCAATAATTGTCT
GGGGTCAGCCGCCACTCCATGACAAAGGACGACCCTTTAAGCCCCCTCAA
AAACCCTGCTGCTTCTTCAATGCCGACATCGAGGACAAATGGTGGGCCGA
ACTGCGCTTTCCCATCCGCAAGGCTGCTCTCAAAGCCAGGATAACTCCGC
GCATCCTTAGCCTGTCGAAACCAAAGATCACGCCTCAGTTCCCACCGCAT
TGCTATCATCCGGAGCATATATATGACGTGCTTAATGTCAAACCGCCACG
GAGGAAGAAGTTTACTCCCCAGGGATGGCGTCTCCACCAGATCAGATTGC
TATATCTTTCGAAGCCTGTGTCCCGGCCCGAATACGAGTATTTTTATATG
TAATATCGTGTCATATAGCGCCCATAATGTTTTTGATCTAAAGTTTGTGT
TTGATGTAATCTGTTTTCAAAATTTAATATTTTCAAAATTAATATTTTTT
GAATGAAAACAAATATCTGAAGAAGACTGAATCTTCCATACTGAAAAAAA
AAAAAAAAAAAA

AT12577.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3581-RA 993 CG3581-RA 1..993 1..993 4965 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15197669..15198661 993..1 4965 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:46:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19373756..19374749 994..1 4970 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19114587..19115580 994..1 4970 100 Minus
Blast to na_te.dros performed 2019-03-15 15:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1430..1507 957..879 141 67.9 Minus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2484..2537 965..914 130 76.4 Minus
rover 7318 rover ROVER 7318bp 3975..4061 939..855 114 62.1 Minus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 593..703 949..839 113 58 Minus

AT12577.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:17:39 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15197669..15198661 1..993 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:26 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..762 92..853 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:06:02 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..762 92..853 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:10:10 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..762 92..853 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:55:32 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..762 92..853 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:48 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..762 92..853 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:43:57 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..993 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:06:02 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..993 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:10:10 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 41..1033 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:55:32 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 1..993 1..993 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:48 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
CG3581-RA 41..1033 1..993 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19373757..19374749 1..993 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19373757..19374749 1..993 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:39 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19373757..19374749 1..993 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:10:10 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15199479..15200471 1..993 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:27:50 Download gff for AT12577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19114588..19115580 1..993 100   Minus

AT12577.pep Sequence

Translation from 91 to 852

> AT12577.pep
MSMIQEETKASVISVVKPPPSWVEWCERNAKPIERRLIKERRYLTRWQIP
GPMKKAQWREFYEWAASRAMPKELPVPVKQPIPCVDKFLPCARKPRAIDP
DEFQEKVAKLATPLERKMTPKHQYIYPVQPYSPIIVWGQPPLHDKGRPFK
PPQKPCCFFNADIEDKWWAELRFPIRKAALKARITPRILSLSKPKITPQF
PPHCYHPEHIYDVLNVKPPRRKKFTPQGWRLHQIRLLYLSKPVSRPEYEY
FYM*

AT12577.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18464-PA 254 GF18464-PA 1..254 1..253 919 69.7 Plus
Dana\GF19945-PA 265 GF19945-PA 21..262 7..252 631 53.8 Plus
Dana\GF18463-PA 237 GF18463-PA 10..229 21..245 264 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16030-PA 253 GG16030-PA 1..253 1..253 1172 94.9 Plus
Dere\GG16019-PA 278 GG16019-PA 28..275 2..252 548 49.8 Plus
Dere\GG16008-PA 236 GG16008-PA 10..226 21..245 272 34.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3581-PA 253 CG3581-PA 1..253 1..253 1410 100 Plus
CG31404-PA 274 CG31404-PA 30..274 4..251 605 50.8 Plus
CG31245-PA 237 CG31245-PA 10..227 21..245 279 33.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11969-PA 259 GL11969-PA 24..259 19..253 642 59.3 Plus
Dper\GL12645-PA 256 GL12645-PA 27..256 17..253 542 48.1 Plus
Dper\GL11968-PA 250 GL11968-PA 12..238 24..245 205 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17535-PB 259 GA17535-PB 24..259 19..253 642 59.3 Plus
Dpse\GA27579-PA 256 GA27579-PA 27..256 17..253 539 47.7 Plus
Dpse\GA16119-PB 250 GA16119-PB 12..238 24..245 190 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26912-PA 253 GM26912-PA 1..253 1..253 1294 98.4 Plus
Dsec\GM26911-PA 207 GM26911-PA 29..182 3..158 304 46.8 Plus
Dsec\GM26910-PA 236 GM26910-PA 10..226 21..245 245 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20118-PA 253 GD20118-PA 1..253 1..253 1292 98.4 Plus
Dsim\GD20117-PA 196 GD20117-PA 1..196 53..251 441 51.2 Plus
Dsim\GD20116-PA 236 GD20116-PA 10..226 21..245 249 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13479-PA 1892 GK13479-PA 1502..1705 20..222 561 54.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25133-PA 253 GE25133-PA 1..253 1..253 1156 92.9 Plus
Dyak\GE25132-PA 278 GE25132-PA 41..275 15..252 538 50.8 Plus
Dyak\GE25131-PA 236 GE25131-PA 10..226 21..245 269 33.3 Plus

AT12577.hyp Sequence

Translation from 91 to 852

> AT12577.hyp
MSMIQEETKASVISVVKPPPSWVEWCERNAKPIERRLIKERRYLTRWQIP
GPMKKAQWREFYEWAASRAMPKELPVPVKQPIPCVDKFLPCARKPRAIDP
DEFQEKVAKLATPLERKMTPKHQYIYPVQPYSPIIVWGQPPLHDKGRPFK
PPQKPCCFFNADIEDKWWAELRFPIRKAALKARITPRILSLSKPKITPQF
PPHCYHPEHIYDVLNVKPPRRKKFTPQGWRLHQIRLLYLSKPVSRPEYEY
FYM*

AT12577.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3581-PA 253 CG3581-PA 1..253 1..253 1410 100 Plus
CG31404-PA 274 CG31404-PA 30..274 4..251 605 50.8 Plus
CG31245-PA 237 CG31245-PA 10..227 21..245 279 33.5 Plus