Clone AT12780 Report

Search the DGRC for AT12780

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:127
Well:80
Vector:pOTB7
Associated Gene/TranscriptCG3611-RA
Protein status:AT12780.pep: gold
Preliminary Size:676
Sequenced Size:791

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3611 2002-01-01 Sim4 clustering to Release 2
CG3611 2002-04-26 Blastp of sequenced clone
CG3611 2003-01-01 Sim4 clustering to Release 3
CG3611 2008-04-29 Release 5.5 accounting
CG3611 2008-08-15 Release 5.9 accounting
CG3611 2008-12-18 5.12 accounting

Clone Sequence Records

AT12780.complete Sequence

791 bp (791 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113246

> AT12780.complete
GTGACGAAAGTTAACTTAAACATGTACATAGGTTTCAGACTAGGCCAGTT
CGTAAGCGTTAACAATTATGTGCAGAGTTTCTGCACAGGTGGCTGGCAGT
GACCTGGATGCACTGCACCTGTCGTCTGTCAAGTGGCTGCTAATGCGATT
AGGGAGCACACAGAAAACGGGATTGGCACTCGGGACTGGCAACTCAGCTG
CCAATCAGGTGGGCCAGCCACAAACTTCACACATTTCGGACACATATATC
AATCCACTCCACAACCAGAAGGACACGAAGTAAAGTAAACACAACCCCAC
ACCCCTGACAAGATGCCGGCGGACATAGTGACCACGGAGCAGCTGCGCTA
CCAGCTCGCCTTCAGTCATGCCATGGAAAGGACGACGAGGCACTGGCAGG
AGACTTTCGCGTGGTACCCTAAGATGCAGTGCTGCCATTATCAGCGGATT
GACCAGATCTATCTGACGAGTCGCCAGCGGTACGGCGACGGCCACTTCCT
CAAGTACGCCAACCGCAGGCGCCTGGCAAAGAAGTTCGTGGTTACCGCCC
AGGAGGTTGCGGAAGGTTTGGAGGATCTGAAGATGCTGGAGCAAGACGGC
ATTACGGGCCTCAAAGTTGCGGTCACCGAGAACGGGGAGTACGGCCGAAT
GAAGCCCTCCAAGCTGTACATGTGCTAGGACACCCTGTGACCAGCCGGCC
CGCTCTGCTCCCCAATCCTCGCCAGAACCCCTCACGATTAAACTATCATT
CTCTGCTGACAATGCAAAAAAAAAAAAAAAAAAAAAAAAAA

AT12780.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3611-RA 765 CG3611-RA 1..765 1..765 3810 99.8 Plus
CG3611.b 1126 CG3611.b 202..707 262..767 2500 99.6 Plus
CG3611.a 705 CG3611.a 202..705 262..765 2490 99.6 Plus
CG3611.b 1126 CG3611.b 1..208 1..208 1040 100 Plus
CG3611.a 705 CG3611.a 1..208 1..208 1040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20684738..20685502 1..765 3810 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24798798..24799564 1..767 3820 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24799997..24800763 1..767 3820 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 19:02:33 has no hits.

AT12780.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:40 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20684738..20685502 1..765 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:56 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..366 313..678 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:50 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..366 313..678 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:54 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..366 313..678 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:12 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..366 313..678 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:17 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..366 313..678 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:30 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..765 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:50 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..765 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:54 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..765 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:12 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..765 1..765 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:17 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
CG3611-RA 1..765 1..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:40 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24798798..24799562 1..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:40 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24798798..24799562 1..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:40 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24798798..24799562 1..765 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:54 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20686321..20687085 1..765 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:04 Download gff for AT12780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24800015..24800779 1..765 99   Plus

AT12780.pep Sequence

Translation from 312 to 677

> AT12780.pep
MPADIVTTEQLRYQLAFSHAMERTTRHWQETFAWYPKMQCCHYQRIDQIY
LTSRQRYGDGHFLKYANRRRLAKKFVVTAQEVAEGLEDLKMLEQDGITGL
KVAVTENGEYGRMKPSKLYMC*

AT12780.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11537-PA 123 GF11537-PA 1..123 1..121 375 58.5 Plus
Dana\GF14787-PA 130 GF14787-PA 6..123 4..121 175 31.4 Plus
Dana\GF14786-PA 124 GF14786-PA 6..123 4..121 167 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23008-PA 121 GG23008-PA 1..121 1..121 594 90.1 Plus
Dere\GG21075-PA 124 GG21075-PA 5..123 3..121 158 27.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20361-PA 119 GH20361-PA 1..119 1..121 235 39.2 Plus
Dgri\GH20359-PA 67 GH20359-PA 1..65 1..65 133 36.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3611-PB 121 CG3611-PB 1..121 1..121 649 100 Plus
CG3611-PC 121 CG3611-PC 1..121 1..121 649 100 Plus
CG3611-PA 121 CG3611-PA 1..121 1..121 649 100 Plus
CG34169-PA 124 CG34169-PA 5..123 3..121 171 31.5 Plus
CG34106-PB 122 CG34106-PB 5..118 5..118 164 29.8 Plus
CG34106-PA 122 CG34106-PA 5..118 5..118 164 29.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20033-PA 121 GI20033-PA 1..121 1..121 238 38.8 Plus
Dmoj\GI14285-PA 139 GI14285-PA 10..127 5..121 186 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16776-PA 119 GL16776-PA 1..119 1..121 265 45.9 Plus
Dper\GL22399-PA 122 GL22399-PA 6..121 5..121 174 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17557-PA 119 GA17557-PA 1..119 1..121 262 45.9 Plus
Dpse\GA28933-PA 122 GA28933-PA 6..121 5..121 174 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11902-PA 121 GM11902-PA 1..121 1..121 654 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11899-PA 121 GD11899-PA 1..121 1..121 654 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21276-PA 121 GJ21276-PA 1..121 1..121 227 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21674-PA 121 GK21674-PA 1..121 1..121 261 43.9 Plus
Dwil\GK19082-PA 129 GK19082-PA 1..124 1..121 190 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14445-PA 121 GE14445-PA 1..121 1..121 592 89.3 Plus

AT12780.hyp Sequence

Translation from 312 to 677

> AT12780.hyp
MPADIVTTEQLRYQLAFSHAMERTTRHWQETFAWYPKMQCCHYQRIDQIY
LTSRQRYGDGHFLKYANRRRLAKKFVVTAQEVAEGLEDLKMLEQDGITGL
KVAVTENGEYGRMKPSKLYMC*

AT12780.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3611-PB 121 CG3611-PB 1..121 1..121 649 100 Plus
CG3611-PC 121 CG3611-PC 1..121 1..121 649 100 Plus
CG3611-PA 121 CG3611-PA 1..121 1..121 649 100 Plus
CG34169-PA 124 CG34169-PA 5..123 3..121 171 31.5 Plus
CG34106-PB 122 CG34106-PB 5..118 5..118 164 29.8 Plus