Clone AT12815 Report

Search the DGRC for AT12815

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:128
Well:15
Vector:pOTB7
Associated Gene/TranscriptRacGAP84C-RA
Protein status:AT12815.pep: gold
Preliminary Size:1275
Sequenced Size:1447

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2595 2002-01-01 Sim4 clustering to Release 2
CG2595 2002-01-11 Blastp of sequenced clone
CG2595 2003-01-01 Sim4 clustering to Release 3
RacGAP84C 2008-04-29 Release 5.5 accounting
RacGAP84C 2008-08-15 Release 5.9 accounting
RacGAP84C 2008-12-18 5.12 accounting
CG2595 2011-03-01 Transcript Validation

Clone Sequence Records

AT12815.complete Sequence

1447 bp (1447 high quality bases) assembled on 2002-01-11

GenBank Submission: AY075179

> AT12815.complete
ATAAACCGTAAGAGTAAATAAACATTTCGGTCGAGTATTCGGGGAAGCGA
GCCGATAACTTCTGCGTAGCTGACTCAAGCCGAAGTGGCCTCTCTTCGGA
AATTGCCAACTGACCAGAACAGCTGAATCAATTCGCCAACTTTATGATTA
GTGGCTCTGGGAGTCGGACGCCCTCAAATCGACTTTATTTGTCGCCCGTT
CGCCCCACGATGCAGAACAAACGGAGGCTTCTGCGGGAGTACAGGTCCTA
CGATGACCTCAGCGAGCACTACCGCATGTTTGGATCGCAGTCCCTGGACT
CGCTGCAGGATCGCGTGGACATGAATCCCAGTGGCTGCGATGGCTTATCC
ACGGACGGACTCGACTTCTGCTCGCAGTCCCACTCGGGGCTGCTGAGGGA
GCACAATTTCAAGATTAAGTCCTACTACTACAACGTGGGGAACTGCGTAC
ACTGCCGCAAAAGGATCCGCTTCGCCATGGCCAGCCTGAGGTGTCGGGCG
TGTCCGCTCCGCTGCCACATCGGTTGCTGCCGCCAGCTGACGGTGAACTG
CATCCCCCAGCCTCAAATCGGTACGAAGAGAGGATGTCTCAGCGATTATG
CGCCTCGGGTGGCGCCCATGGTGCCGGCCTTAATTGTCCATTGTGTAACG
GAGATCGAGGCGCGGGGATTGCAGCAGGAGGGACTCTACCGGGTGTCCTC
CACCCGAGAGAAATGCAAACGACTGCGTCGGAAGCTGCTGCGTGGCAAGT
CCACGCCGCATTTGGGCAATAAAGACACCCACACACTGTGCTGTTGTGTT
AAGGACTTTCTTCGGCAGTTGGTTCACCCTCTGATTCCCATTTACCACCG
AAGGGATTTCGAGGAGGCCACGCGGCACGAAGATCGTCTGGCTGTGGAGA
TGGCGGTATATTTAGCGGTTCTGGAGCTGCATCAGGCTCACAGGGATACG
TTGGCCTACTTAATGCTTCACTGGCAGAAAATTGCCGAAAGTCCTGCTGT
CCGCATGACGGTCAACAATCTTGCCGTGATCTTCGCTCCAACTCTGTTCG
GAGATCTGGATCTAACCCTCGAAAATGTCGTCACTTGGCAGCGGGTGCTG
AAGGTGCTACTTCTGATGCCTGCCGGATTTTGGTCTCAGTTCTTGGAGGT
CCATCCCCTTCCCACTTCGTTGGGCAGCACCTATGACTTTGAGGACCGGT
ACAATCACCGTCACTGGGACAGCTCGTCCAATCTGGGATGGTCTTCTGTT
AAGACCTACTTTAGATCAATGGTCAACCTTAGCAGTACTCACCTATAGTG
AAAGTCTTATGACTGAGACATCGAGAATGGATGCAGTCACCCTTTTTCAT
TTTATTTTGTATTTTTTTTCATTATTCACTACAGTTGAAGAACTAATAAT
AATTGGATCTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT12815.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
RacGAP84C.a 2179 RacGAP84C.a 600..2013 1..1414 7040 99.8 Plus
RacGAP84C-RA 2014 RacGAP84C-RA 600..2013 1..1414 7040 99.8 Plus
RacGAP84C-RB 1953 RacGAP84C-RB 600..1872 1..1273 6350 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3112662..3113473 462..1273 4060 100 Plus
chr3R 27901430 chr3R 3112065..3112528 1..464 2305 99.8 Plus
chr3R 27901430 chr3R 3113591..3113732 1271..1412 695 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7286559..7287370 462..1273 4060 100 Plus
3R 32079331 3R 7285962..7286425 1..464 2305 99.8 Plus
3R 32079331 3R 7287488..7287631 1271..1414 705 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7027390..7028201 462..1273 4060 100 Plus
3R 31820162 3R 7026793..7027256 1..464 2305 99.7 Plus
3R 31820162 3R 7028319..7028462 1271..1414 705 99.3 Plus
Blast to na_te.dros performed on 2019-03-15 19:02:36 has no hits.

AT12815.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:41 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3112065..3112527 1..463 99 -> Plus
chr3R 3112664..3113471 464..1271 100 -> Plus
chr3R 3113592..3113732 1272..1412 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:02:58 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1155 144..1298 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:01 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1155 144..1298 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:57 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1155 144..1298 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:16:49 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1155 144..1298 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:19 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1155 144..1298 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:13:55 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 600..2011 1..1412 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:01 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 600..2011 1..1412 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:57 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1412 1..1412 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:16:49 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 600..2011 1..1412 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:19 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
RacGAP84C-RA 1..1412 1..1412 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:41 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7285962..7286424 1..463 99 -> Plus
3R 7286561..7287368 464..1271 100 -> Plus
3R 7287489..7287629 1272..1412 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:41 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7285962..7286424 1..463 99 -> Plus
3R 7286561..7287368 464..1271 100 -> Plus
3R 7287489..7287629 1272..1412 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:41 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7285962..7286424 1..463 99 -> Plus
3R 7286561..7287368 464..1271 100 -> Plus
3R 7287489..7287629 1272..1412 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:57 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3111684..3112146 1..463 99 -> Plus
arm_3R 3112283..3113090 464..1271 100 -> Plus
arm_3R 3113211..3113351 1272..1412 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:50:51 Download gff for AT12815.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7026793..7027255 1..463 99 -> Plus
3R 7027392..7028199 464..1271 100 -> Plus
3R 7028320..7028460 1272..1412 99   Plus

AT12815.hyp Sequence

Translation from 143 to 1297

> AT12815.hyp
MISGSGSRTPSNRLYLSPVRPTMQNKRRLLREYRSYDDLSEHYRMFGSQS
LDSLQDRVDMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYYYNVGN
CVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQIGTKRGCLS
DYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLR
GKSTPHLGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLA
VEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPT
LFGDLDLTLENVVTWQRVLKVLLLMPAGFWSQFLEVHPLPTSLGSTYDFE
DRYNHRHWDSSSNLGWSSVKTYFRSMVNLSSTHL*

AT12815.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
RacGAP84C-PA 384 CG2595-PA 1..384 1..384 2062 100 Plus
RacGAP84C-PB 383 CG2595-PB 1..377 1..377 2027 100 Plus
tum-PA 625 CG13345-PA 312..581 80..341 679 48.3 Plus
RhoGAP5A-PA 494 CG3208-PA 240..463 85..301 213 29.1 Plus
RhoGAP18B-PH 468 CG42274-PH 289..440 158..310 156 31 Plus

AT12815.pep Sequence

Translation from 143 to 1297

> AT12815.pep
MISGSGSRTPSNRLYLSPVRPTMQNKRRLLREYRSYDDLSEHYRMFGSQS
LDSLQDRVDMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYYYNVGN
CVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQIGTKRGCLS
DYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLR
GKSTPHLGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLA
VEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPT
LFGDLDLTLENVVTWQRVLKVLLLMPAGFWSQFLEVHPLPTSLGSTYDFE
DRYNHRHWDSSSNLGWSSVKTYFRSMVNLSSTHL*

AT12815.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17669-PA 361 GF17669-PA 1..361 23..384 1577 83 Plus
Dana\GF11159-PA 624 GF11159-PA 312..576 80..336 702 50 Plus
Dana\GF21287-PA 506 GF21287-PA 254..479 85..303 204 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13997-PA 362 GG13997-PA 1..362 23..384 1836 94.2 Plus
Dere\GG22464-PA 625 GG22464-PA 312..581 80..341 681 48 Plus
Dere\GG18490-PA 492 GG18490-PA 238..463 85..303 209 28.4 Plus
Dere\GG16384-PA 200 GG16384-PA 1..157 159..302 166 31 Plus
Dere\GG18077-PA 238 GG18077-PA 59..210 158..310 152 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18301-PA 355 GH18301-PA 3..354 31..380 1192 64 Plus
Dgri\GH20864-PA 621 GH20864-PA 312..577 83..340 689 49.4 Plus
Dgri\GH24923-PA 502 GH24923-PA 249..473 85..303 209 28.5 Plus
Dgri\GH24224-PA 358 GH24224-PA 119..330 105..310 170 29.4 Plus
Dgri\GH23982-PA 265 GH23982-PA 4..161 160..304 160 30.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
RacGAP84C-PA 384 CG2595-PA 1..384 1..384 2062 100 Plus
RacGAP84C-PB 383 CG2595-PB 1..377 1..377 2027 100 Plus
tum-PA 625 CG13345-PA 312..581 80..341 679 48.3 Plus
RhoGAP5A-PA 494 CG3208-PA 240..463 85..301 213 29.1 Plus
RhoGAP18B-PH 468 CG42274-PH 289..440 158..310 156 31 Plus
RhoGAP18B-PF 468 CG42274-PF 289..440 158..310 156 31 Plus
RhoGAP18B-PB 468 CG7481-PA 289..440 158..310 156 31 Plus
RhoGAP18B-PD 752 CG42274-PD 573..724 158..310 156 31 Plus
RhoGAP18B-PC 1317 CG42274-PC 1138..1289 158..310 156 31 Plus
RhoGAP102A-PC 1074 CG42316-PC 873..1065 159..326 155 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24111-PA 366 GI24111-PA 1..365 23..380 1236 65.9 Plus
Dmoj\GI20972-PA 631 GI20972-PA 313..587 77..343 689 48.6 Plus
Dmoj\GI21776-PA 500 GI21776-PA 243..467 85..303 208 28.1 Plus
Dmoj\GI14109-PA 182 GI14109-PA 3..160 160..304 161 31.4 Plus
Dmoj\GI15727-PA 1459 GI15727-PA 1280..1443 158..323 157 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12436-PA 372 GL12436-PA 1..370 23..381 1353 69.9 Plus
Dper\GL16993-PA 500 GL16993-PA 189..453 80..336 708 50 Plus
Dper\GL14655-PA 310 GL14655-PA 131..282 158..310 154 32.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15397-PB 375 GA15397-PB 1..364 23..384 1382 71.3 Plus
Dpse\GA12222-PA 624 GA12222-PA 312..576 80..336 703 49.6 Plus
Dpse\GA16662-PA 490 GA16662-PA 240..463 87..303 221 29.5 Plus
Dpse\GA22300-PA 310 GA22300-PA 131..282 158..310 155 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10949-PA 362 GM10949-PA 1..362 23..384 1920 98.3 Plus
Dsec\GM20250-PA 625 GM20250-PA 312..581 80..341 680 47.6 Plus
Dsec\GM12638-PA 494 GM12638-PA 240..465 85..303 210 28.8 Plus
Dsec\GM22767-PA 238 GM22767-PA 59..203 158..303 166 33.3 Plus
Dsec\GM26791-PA 198 GM26791-PA 1..193 159..326 164 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19928-PA 362 GD19928-PA 1..362 23..384 1909 97.8 Plus
Dsim\GD25736-PA 625 GD25736-PA 312..581 80..341 685 48 Plus
Dsim\GD16254-PA 495 GD16254-PA 240..466 85..303 206 28.7 Plus
Dsim\GD15602-PA 532 GD15602-PA 357..504 158..310 158 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10933-PA 360 GJ10933-PA 1..359 23..380 1258 66.6 Plus
Dvir\GJ20692-PA 626 GJ20692-PA 308..579 77..340 685 49.3 Plus
Dvir\GJ16949-PA 508 GJ16949-PA 253..477 85..303 206 28.1 Plus
Dvir\GJ17092-PA 183 GJ17092-PA 4..161 160..304 164 32.1 Plus
Dvir\GJ15255-PA 1365 GJ15255-PA 1186..1337 158..310 162 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12006-PA 353 GK12006-PA 1..353 29..383 1371 73.8 Plus
Dwil\GK21345-PA 607 GK21345-PA 299..582 77..355 678 46.5 Plus
Dwil\GK24959-PA 512 GK24959-PA 262..485 87..303 219 29.1 Plus
Dwil\GK13678-PA 206 GK13678-PA 27..182 160..302 169 31.8 Plus
Dwil\GK25096-PA 184 GK25096-PA 5..148 158..302 158 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11172-PA 362 GE11172-PA 1..362 23..384 1819 93.4 Plus
Dyak\GE24919-PA 145 GE24919-PA 1..136 23..158 691 94.9 Plus
Dyak\GE13335-PA 625 GE13335-PA 312..578 80..338 684 48.1 Plus
Dyak\GE16808-PA 495 GE16808-PA 241..466 85..303 211 28.8 Plus
Dyak\GE14545-PA 196 GE14545-PA 1..164 159..309 168 30.3 Plus