Clone AT13028 Report

Search the DGRC for AT13028

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:130
Well:28
Vector:pOTB7
Associated Gene/Transcriptdgt2-RA
Protein status:AT13028.pep: gold
Preliminary Size:696
Sequenced Size:832

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16969 2002-01-01 Sim4 clustering to Release 2
CG16969 2002-06-10 Blastp of sequenced clone
CG16969 2003-01-01 Sim4 clustering to Release 3
dgt2 2008-04-29 Release 5.5 accounting
dgt2 2008-08-15 Release 5.9 accounting
dgt2 2008-12-18 5.12 accounting

Clone Sequence Records

AT13028.complete Sequence

832 bp (832 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070785

> AT13028.complete
CGCTTGCCCATTCGAATCAAACAATCAATTTCGGGTCAATTTAAGCATTT
TACCACCTAAATGGATGATCCATCCGCCACGCTCTTGCCCGAACACTCGG
AAGATTTGCGGCTGGCTCGCGATGCGGAGCTGAAGAAGGTGCTCAAGCTG
AAGCTAGTGCTGGACGAGCTAAGACGCCTGGATGTGGGCCCAAATCCGAG
TGATGAAATCAAAAGAGCCCTCAAATTGGTTTCCATTGGAAGTTATGCGC
GACTCGGCGAGATGGAGGGAGCTGGTCAGGAGCAGGTGCTTGGTCTACCG
AGCGGCAGCAGTTTTCCGCCCTTGAATTACACGGATCGCAAGACGGTGCG
TACCAAATTGTCCGCTCAATTACGCACAACTCTGCAACCCATTGCCGAAT
TGTGCGACAGGATACGCGAGGAGTTCCCGGACGCCTTTGGCCAGGAGGCG
GACTTAAGCTGCGACCAAAAGGAGATTCTGCGCCTGGAGGAGGAGCATCG
CAGCGGTCTGGAGAAATTGGTTGCGCTTCTCACTCGTAAGTGCACGCTTC
TCAAGGAGACCGCCGAATTGAAATTGGGGCCGCAGTTGGCAAACGAACTA
AAATTGCAACAGGCGCAGGCGCAACTTGTTCAAACAAAAGCAGAACTACT
GCGCGGATTTTTCGTCCACGAGGCCGCCTCTCGCACCGAACATAGCGTCA
AGGCACATAAGGAGGTGGAGGCGCACCTGGACGAGCTGCTCGCCGCCAAG
AAGTAGATTTAAGCAAACTAGTATTATGTAAATTAGATTTTTAAATACAT
TATAATTGTGATTTAAAAAAAAAAAAAAAAAA

AT13028.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
dgt2-RA 872 dgt2-RA 45..861 1..817 4085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11988965..11989487 292..814 2615 100 Plus
chr2L 23010047 chr2L 11988617..11988910 1..294 1470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11990312..11990837 292..817 2630 100 Plus
2L 23513712 2L 11989964..11990257 1..294 1470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11990312..11990837 292..817 2630 100 Plus
2L 23513712 2L 11989964..11990257 1..294 1470 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:55:40 has no hits.

AT13028.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:56:16 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11988617..11988908 1..292 100 -> Plus
chr2L 11988966..11989487 293..814 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:03:08 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..696 61..756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:04 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..696 61..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:34 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..696 61..756 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:18 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..696 61..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:56:50 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..696 61..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:11 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:04 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 27..840 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:34 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 29..842 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:18 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:56:50 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
dgt2-RA 29..842 1..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:16 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11989964..11990255 1..292 100 -> Plus
2L 11990313..11990834 293..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:16 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11989964..11990255 1..292 100 -> Plus
2L 11990313..11990834 293..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:16 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11989964..11990255 1..292 100 -> Plus
2L 11990313..11990834 293..814 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:34 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11989964..11990255 1..292 100 -> Plus
arm_2L 11990313..11990834 293..814 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:13:59 Download gff for AT13028.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11989964..11990255 1..292 100 -> Plus
2L 11990313..11990834 293..814 100   Plus

AT13028.pep Sequence

Translation from 60 to 755

> AT13028.pep
MDDPSATLLPEHSEDLRLARDAELKKVLKLKLVLDELRRLDVGPNPSDEI
KRALKLVSIGSYARLGEMEGAGQEQVLGLPSGSSFPPLNYTDRKTVRTKL
SAQLRTTLQPIAELCDRIREEFPDAFGQEADLSCDQKEILRLEEEHRSGL
EKLVALLTRKCTLLKETAELKLGPQLANELKLQQAQAQLVQTKAELLRGF
FVHEAASRTEHSVKAHKEVEAHLDELLAAKK*

AT13028.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15136-PA 236 GF15136-PA 5..231 3..231 790 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23751-PA 231 GG23751-PA 1..231 1..231 953 87 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13062-PA 230 GH13062-PA 1..227 1..230 559 53.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
dgt2-PB 231 CG16969-PB 1..231 1..231 1149 100 Plus
dgt2-PA 231 CG16969-PA 1..231 1..231 1149 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17682-PA 235 GI17682-PA 3..231 1..231 490 54.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18538-PA 231 GL18538-PA 3..223 5..231 550 58.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14243-PA 231 GA14243-PA 3..223 5..231 549 58.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26683-PA 217 GM26683-PA 1..217 1..231 903 90 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23803-PA 231 GD23803-PA 1..231 1..231 1136 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17467-PA 243 GJ17467-PA 1..229 1..231 543 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15173-PA 227 GK15173-PA 1..224 1..231 579 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18558-PA 231 GE18558-PA 1..231 1..231 918 88.7 Plus

AT13028.hyp Sequence

Translation from 60 to 755

> AT13028.hyp
MDDPSATLLPEHSEDLRLARDAELKKVLKLKLVLDELRRLDVGPNPSDEI
KRALKLVSIGSYARLGEMEGAGQEQVLGLPSGSSFPPLNYTDRKTVRTKL
SAQLRTTLQPIAELCDRIREEFPDAFGQEADLSCDQKEILRLEEEHRSGL
EKLVALLTRKCTLLKETAELKLGPQLANELKLQQAQAQLVQTKAELLRGF
FVHEAASRTEHSVKAHKEVEAHLDELLAAKK*

AT13028.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
dgt2-PB 231 CG16969-PB 1..231 1..231 1149 100 Plus
dgt2-PA 231 CG16969-PA 1..231 1..231 1149 100 Plus