BDGP Sequence Production Resources |
Search the DGRC for AT13484
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 134 |
Well: | 84 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG32161-RA |
Protein status: | AT13484.pep: gold |
Sequenced Size: | 828 |
Gene | Date | Evidence |
---|---|---|
CG32161 | 2003-01-01 | Sim4 clustering to Release 3 |
CG32161 | 2004-10-25 | Blastp of sequenced clone |
CG32161 | 2008-04-29 | Release 5.5 accounting |
CG32161 | 2008-08-15 | Release 5.9 accounting |
CG32161 | 2008-12-18 | 5.12 accounting |
828 bp (828 high quality bases) assembled on 2004-10-25
GenBank Submission: BT016156
> AT13484.complete CATTAGGCTGCTTTCATCCTTTTCAAAACTATTTCGTTGGCGTGCTTTCA AAATTCTCCATAACCTTCCAATGATGACCTGCTTCCTCAGTCGCTTTCTG GGCCTGGGCAGGTGCGGTCTGCAGGTGCTCGAAAGGCGGATGGGCCATTT CAACCATTGCACCTTGGCCCTGGCCACTCTCGACCTTGTCTGCATTGTTT GCCTGCTCCATTACCAACTGGCGCGGCATGGCCGAGATCTGTTTTTTTGG TGCGAGGAACTGGACCAACGACTAGTGGAGTACATGCTATCTGCAGTCGT ATTGATGGCCAGCGTTAGTGTGCTGGGCTCGTGCGTGGATGGCTTTATCT TCTCTGCCTTGGTTCAGCGGAAAATGAGTCGGTTTGATATGCCGCGACAG TATTTTGAAGATCGTTACCGCAGATTCGTCTTCATGCGGCTGGTCAGGCA ACTAGAGCAGGCTCTCAAAGTGCAGGCTAAGCAGTCTGAGTTGGGCGAAA GAATGATGACGCCACTCGCCAATCTGTTCGAGGCGCAGCAGCTGATCAAG GAGGCAATCGATGAGTTTCGCACAGCGGTGCGAGTCCTACTGTGGCCCAA TCGATCCGATGTGCTGGCAGAGGCGTTTGTCCTCTTCCACATTAGCGAAT CGCAGTTGTCGGATCTGACACTTCAAGGCTACAGGCTGAACGACGTCGAG GGGGAAGACATGTCCAATTCCCGTCTTAGTCAAATGCTTAACCCACTTTG GTATTAAAATTGGTGCTATAGTTCAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32161-RA | 774 | CG32161-RA | 1..774 | 1..774 | 3840 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16835728..16836501 | 1..774 | 3870 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16846227..16847005 | 1..779 | 3850 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16839327..16840105 | 1..779 | 3850 | 99.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16835728..16836501 | 1..774 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..687 | 71..757 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..687 | 71..757 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..687 | 71..757 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..687 | 71..757 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..687 | 71..757 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..769 | 1..769 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..774 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..774 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..769 | 1..769 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32161-RA | 1..774 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16846227..16847000 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16846227..16847000 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16846227..16847000 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16839327..16840100 | 1..774 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16839327..16840100 | 1..774 | 99 | Plus |
Translation from 1 to 756
> AT13484.hyp IRLLSSFSKLFRWRAFKILHNLPMMTCFLSRFLGLGRCGLQVLERRMGHF NHCTLALATLDLVCIVCLLHYQLARHGRDLFFWCEELDQRLVEYMLSAVV LMASVSVLGSCVDGFIFSALVQRKMSRFDMPRQYFEDRYRRFVFMRLVRQ LEQALKVQAKQSELGERMMTPLANLFEAQQLIKEAIDEFRTAVRVLLWPN RSDVLAEAFVLFHISESQLSDLTLQGYRLNDVEGEDMSNSRLSQMLNPLW Y*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32161-PA | 228 | CG32161-PA | 1..228 | 24..251 | 1174 | 100 | Plus |
Translation from 70 to 756
> AT13484.pep MMTCFLSRFLGLGRCGLQVLERRMGHFNHCTLALATLDLVCIVCLLHYQL ARHGRDLFFWCEELDQRLVEYMLSAVVLMASVSVLGSCVDGFIFSALVQR KMSRFDMPRQYFEDRYRRFVFMRLVRQLEQALKVQAKQSELGERMMTPLA NLFEAQQLIKEAIDEFRTAVRVLLWPNRSDVLAEAFVLFHISESQLSDLT LQGYRLNDVEGEDMSNSRLSQMLNPLWY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20061-PA | 231 | GF20061-PA | 1..231 | 2..228 | 803 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13583-PA | 228 | GG13583-PA | 1..228 | 1..228 | 1121 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16595-PA | 197 | GH16595-PA | 2..197 | 37..228 | 452 | 45.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32161-PA | 228 | CG32161-PA | 1..228 | 1..228 | 1174 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20851-PA | 356 | GL20851-PA | 136..356 | 5..228 | 483 | 45.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16726-PA | 223 | GA16726-PA | 3..223 | 5..228 | 485 | 45.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25662-PA | 228 | GM25662-PA | 1..228 | 1..228 | 1163 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14670-PA | 228 | GD14670-PA | 1..228 | 1..228 | 1167 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12341-PA | 223 | GJ12341-PA | 15..223 | 23..228 | 446 | 43.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19175-PA | 214 | GK19175-PA | 29..211 | 37..225 | 429 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19879-PA | 228 | GE19879-PA | 1..228 | 1..228 | 1118 | 91.7 | Plus |