Clone AT13484 Report

Search the DGRC for AT13484

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:134
Well:84
Vector:pOTB7
Associated Gene/TranscriptCG32161-RA
Protein status:AT13484.pep: gold
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32161 2003-01-01 Sim4 clustering to Release 3
CG32161 2004-10-25 Blastp of sequenced clone
CG32161 2008-04-29 Release 5.5 accounting
CG32161 2008-08-15 Release 5.9 accounting
CG32161 2008-12-18 5.12 accounting

Clone Sequence Records

AT13484.complete Sequence

828 bp (828 high quality bases) assembled on 2004-10-25

GenBank Submission: BT016156

> AT13484.complete
CATTAGGCTGCTTTCATCCTTTTCAAAACTATTTCGTTGGCGTGCTTTCA
AAATTCTCCATAACCTTCCAATGATGACCTGCTTCCTCAGTCGCTTTCTG
GGCCTGGGCAGGTGCGGTCTGCAGGTGCTCGAAAGGCGGATGGGCCATTT
CAACCATTGCACCTTGGCCCTGGCCACTCTCGACCTTGTCTGCATTGTTT
GCCTGCTCCATTACCAACTGGCGCGGCATGGCCGAGATCTGTTTTTTTGG
TGCGAGGAACTGGACCAACGACTAGTGGAGTACATGCTATCTGCAGTCGT
ATTGATGGCCAGCGTTAGTGTGCTGGGCTCGTGCGTGGATGGCTTTATCT
TCTCTGCCTTGGTTCAGCGGAAAATGAGTCGGTTTGATATGCCGCGACAG
TATTTTGAAGATCGTTACCGCAGATTCGTCTTCATGCGGCTGGTCAGGCA
ACTAGAGCAGGCTCTCAAAGTGCAGGCTAAGCAGTCTGAGTTGGGCGAAA
GAATGATGACGCCACTCGCCAATCTGTTCGAGGCGCAGCAGCTGATCAAG
GAGGCAATCGATGAGTTTCGCACAGCGGTGCGAGTCCTACTGTGGCCCAA
TCGATCCGATGTGCTGGCAGAGGCGTTTGTCCTCTTCCACATTAGCGAAT
CGCAGTTGTCGGATCTGACACTTCAAGGCTACAGGCTGAACGACGTCGAG
GGGGAAGACATGTCCAATTCCCGTCTTAGTCAAATGCTTAACCCACTTTG
GTATTAAAATTGGTGCTATAGTTCAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT13484.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32161-RA 774 CG32161-RA 1..774 1..774 3840 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16835728..16836501 1..774 3870 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16846227..16847005 1..779 3850 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16839327..16840105 1..779 3850 99.6 Plus
Blast to na_te.dros performed on 2019-03-16 16:51:02 has no hits.

AT13484.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:03 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16835728..16836501 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:03 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..687 71..757 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:29:37 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..687 71..757 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:48:08 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..687 71..757 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:13:36 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..687 71..757 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:32 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..687 71..757 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:33:43 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..769 1..769 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:29:37 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..774 1..774 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:48:08 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..774 1..774 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:13:36 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..769 1..769 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:32 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
CG32161-RA 1..774 1..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:03 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16846227..16847000 1..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:03 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16846227..16847000 1..774 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:03 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16846227..16847000 1..774 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:48:08 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16839327..16840100 1..774 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:50:15 Download gff for AT13484.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16839327..16840100 1..774 99   Plus

AT13484.hyp Sequence

Translation from 1 to 756

> AT13484.hyp
IRLLSSFSKLFRWRAFKILHNLPMMTCFLSRFLGLGRCGLQVLERRMGHF
NHCTLALATLDLVCIVCLLHYQLARHGRDLFFWCEELDQRLVEYMLSAVV
LMASVSVLGSCVDGFIFSALVQRKMSRFDMPRQYFEDRYRRFVFMRLVRQ
LEQALKVQAKQSELGERMMTPLANLFEAQQLIKEAIDEFRTAVRVLLWPN
RSDVLAEAFVLFHISESQLSDLTLQGYRLNDVEGEDMSNSRLSQMLNPLW
Y*

AT13484.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32161-PA 228 CG32161-PA 1..228 24..251 1174 100 Plus

AT13484.pep Sequence

Translation from 70 to 756

> AT13484.pep
MMTCFLSRFLGLGRCGLQVLERRMGHFNHCTLALATLDLVCIVCLLHYQL
ARHGRDLFFWCEELDQRLVEYMLSAVVLMASVSVLGSCVDGFIFSALVQR
KMSRFDMPRQYFEDRYRRFVFMRLVRQLEQALKVQAKQSELGERMMTPLA
NLFEAQQLIKEAIDEFRTAVRVLLWPNRSDVLAEAFVLFHISESQLSDLT
LQGYRLNDVEGEDMSNSRLSQMLNPLWY*

AT13484.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20061-PA 231 GF20061-PA 1..231 2..228 803 67.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13583-PA 228 GG13583-PA 1..228 1..228 1121 92.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16595-PA 197 GH16595-PA 2..197 37..228 452 45.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32161-PA 228 CG32161-PA 1..228 1..228 1174 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20851-PA 356 GL20851-PA 136..356 5..228 483 45.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16726-PA 223 GA16726-PA 3..223 5..228 485 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25662-PA 228 GM25662-PA 1..228 1..228 1163 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14670-PA 228 GD14670-PA 1..228 1..228 1167 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12341-PA 223 GJ12341-PA 15..223 23..228 446 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19175-PA 214 GK19175-PA 29..211 37..225 429 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19879-PA 228 GE19879-PA 1..228 1..228 1118 91.7 Plus