Clone AT13486 Report

Search the DGRC for AT13486

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:134
Well:86
Vector:pOTB7
Associated Gene/TranscriptCG4286-RA
Protein status:AT13486.pep: gold
Preliminary Size:748
Sequenced Size:806

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4286 2002-01-01 Sim4 clustering to Release 2
CG4286 2002-06-10 Blastp of sequenced clone
CG4286 2003-01-01 Sim4 clustering to Release 3
CG4286 2008-04-29 Release 5.5 accounting
CG4286 2008-08-15 Release 5.9 accounting
CG4286 2008-12-18 5.12 accounting

Clone Sequence Records

AT13486.complete Sequence

806 bp (806 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070788

> AT13486.complete
ACTCCCCCAAATTCGAACCCCCTTCCAACCATCCGCCCCTCCATTCATCT
TGGAGAACCAAAGTCATGGCGCACCGCCTCCAGCTCCGTAGCGATGACTT
CGACGTTATCGGCGCCGTGCCCCGCAATCTGTCCGTGATCAAGAACTTCC
TGAAGCGGGACTGTGCCATCAAGAAACTGATCGACATCGAGGAGGAGTTC
CTGCAGGAGTGCGTATTACGCGGCCAGGATCCCATGAATCCGAAGGGTAA
ACGTGACAGTGACAGTGGGCCACATGGTAGTGGTTTGGGATCCAATGTGC
CCGAACCCAAGCCGGATCCATGTGCTACCAAGACACCGGAGAACACATTG
GCCTCCGACTACTGTGATCCCTGTCGCCGACTCAAGACCTCCGTGGTTCT
CGAAGAGCTAACCAAGCCGGCCATCACAAATCCGGCTTTCAACAAATCCC
TGCCGCCGTACTTCGATGAAGAGAGCGTGATGGGCAACTCGTTGCCCGTG
AAGTTCCGTTTCCGGCGCAAGTTCAACAAGTGCGACCAGGAGAAGGCCGG
CAACCTGATGTGCACCAACACGCCGAGCACCAATGTGGTCGTGTTGACCA
ACTGTTGCGATGTGATGGTCTGGCCCAGTCAACGGGTGGCCCAGATGAAC
CGGGTGCCGGTGACCATGCTGTCGGGCGAAGCCGATCTCACGGAGTACAT
GCTGGAGGAGGAGACCATTATGTGAGGGAATGGTTGGATGGGTGCAGCTT
TTTGGCACATAACGCCGATCAATAAAGCATAAAACCCCAAAAAAAAAAAA
AAAAAA

AT13486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4286-RA 990 CG4286-RA 136..922 1..787 3845 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17064654..17065064 411..1 2040 99.8 Minus
chr2R 21145070 chr2R 17064215..17064597 788..406 1900 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21178196..21178602 407..1 1990 99.3 Minus
2R 25286936 2R 21177754..21178135 787..406 1865 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21179395..21179801 407..1 1990 99.2 Minus
2R 25260384 2R 21178953..21179334 787..406 1865 99.2 Minus
Blast to na_te.dros performed on 2019-03-16 12:31:07 has no hits.

AT13486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:31:52 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17064215..17064595 408..788 99 <- Minus
chr2R 17064658..17065064 1..407 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:05 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 1..660 66..725 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:19 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 1..660 66..725 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:41:13 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 1..660 66..725 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:50 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 1..660 66..725 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:47:22 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 1..660 66..725 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:07 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 35..821 1..788 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:19 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 35..821 1..788 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:41:13 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 35..821 1..788 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:50 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 35..821 1..788 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:47:22 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
CG4286-RA 35..821 1..788 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:52 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21177754..21178133 408..788 99 <- Minus
2R 21178196..21178602 1..407 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:52 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21177754..21178133 408..788 99 <- Minus
2R 21178196..21178602 1..407 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:52 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21177754..21178133 408..788 99 <- Minus
2R 21178196..21178602 1..407 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:41:13 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17065259..17065638 408..788 99 <- Minus
arm_2R 17065701..17066107 1..407 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:02 Download gff for AT13486.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21178953..21179332 408..788 99 <- Minus
2R 21179395..21179801 1..407 99   Minus

AT13486.hyp Sequence

Translation from 2 to 724

> AT13486.hyp
SPKFEPPSNHPPLHSSWRTKVMAHRLQLRSDDFDVIGAVPRNLSVIKNFL
KRDCAIKKLIDIEEEFLQECVLRGQDPMNPKGKRDSDSGPHGSGLGSNVP
EPKPDPCATKTPENTLASDYCDPCRRLKTSVVLEELTKPAITNPAFNKSL
PPYFDEESVMGNSLPVKFRFRRKFNKCDQEKAGNLMCTNTPSTNVVVLTN
CCDVMVWPSQRVAQMNRVPVTMLSGEADLTEYMLEEETIM*

AT13486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG4286-PA 219 CG4286-PA 1..219 22..240 1165 100 Plus
CG30278-PC 275 CG30278-PC 96..221 113..238 172 33.1 Plus
CG30278-PB 275 CG30278-PB 96..221 113..238 172 33.1 Plus
CG30278-PA 275 CG30278-PA 96..221 113..238 172 33.1 Plus

AT13486.pep Sequence

Translation from 65 to 724

> AT13486.pep
MAHRLQLRSDDFDVIGAVPRNLSVIKNFLKRDCAIKKLIDIEEEFLQECV
LRGQDPMNPKGKRDSDSGPHGSGLGSNVPEPKPDPCATKTPENTLASDYC
DPCRRLKTSVVLEELTKPAITNPAFNKSLPPYFDEESVMGNSLPVKFRFR
RKFNKCDQEKAGNLMCTNTPSTNVVVLTNCCDVMVWPSQRVAQMNRVPVT
MLSGEADLTEYMLEEETIM*

AT13486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12970-PA 220 GF12970-PA 1..220 1..219 941 80 Plus
Dana\GF12323-PA 274 GF12323-PA 96..221 92..217 180 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20796-PA 219 GG20796-PA 1..219 1..219 1084 92.2 Plus
Dere\GG20708-PA 275 GG20708-PA 97..222 92..217 162 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21170-PA 223 GH21170-PA 1..223 1..219 717 61.4 Plus
Dgri\GH20437-PA 262 GH20437-PA 37..212 11..215 154 27.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG4286-PA 219 CG4286-PA 1..219 1..219 1165 100 Plus
CG30278-PC 275 CG30278-PC 96..221 92..217 172 33.1 Plus
CG30278-PB 275 CG30278-PB 96..221 92..217 172 33.1 Plus
CG30278-PA 275 CG30278-PA 96..221 92..217 172 33.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18765-PA 213 GI18765-PA 1..213 1..219 679 60.3 Plus
Dmoj\GI19619-PA 140 GI19619-PA 4..110 112..219 152 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10168-PA 211 GL10168-PA 1..211 1..219 729 67.1 Plus
Dper\GL16937-PA 261 GL16937-PA 34..220 1..217 196 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18082-PA 211 GA18082-PA 1..211 1..219 726 67.6 Plus
Dpse\GA15746-PA 261 GA15746-PA 49..220 21..217 197 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15741-PA 219 GM15741-PA 1..219 1..219 1144 97.3 Plus
Dsec\GM15652-PA 271 GM15652-PA 96..221 92..217 166 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25219-PA 219 GD25219-PA 1..219 1..219 1144 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21789-PA 218 GJ21789-PA 1..218 1..219 728 64.5 Plus
Dvir\GJ14986-PA 255 GJ14986-PA 35..214 11..215 210 31.2 Plus
Dvir\GJ14988-PA 265 GJ14988-PA 51..214 23..215 172 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21399-PA 218 GK21399-PA 1..218 1..219 630 60.8 Plus
Dwil\GK20835-PA 306 GK20835-PA 152..269 100..217 184 34.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13735-PA 219 GE13735-PA 1..219 1..219 1056 90.9 Plus
Dyak\GE11691-PA 275 GE11691-PA 97..222 92..217 166 33.1 Plus