Clone AT13511 Report

Search the DGRC for AT13511

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:135
Well:11
Vector:pOTB7
Associated Gene/TranscriptTim17b2-RA
Protein status:AT13511.pep: gold
Preliminary Size:1242
Sequenced Size:744

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15257 2002-01-01 Sim4 clustering to Release 2
CG15257 2002-10-29 Blastp of sequenced clone
CG15257 2003-01-01 Sim4 clustering to Release 3
Tim17b2 2008-04-29 Release 5.5 accounting
Tim17b2 2008-08-15 Release 5.9 accounting
Tim17b2 2008-12-18 5.12 accounting

Clone Sequence Records

AT13511.complete Sequence

744 bp (744 high quality bases) assembled on 2002-10-29

GenBank Submission: BT001307

> AT13511.complete
GAAATTTAGCAAATTCAGTTTTTAATTTCGGCCAGTGATAGGAAATCCTG
CCAGTGGAAAAGTGCAAAGATGGAGGAGTATTCGCGGGAACCGTGTCCCC
ATCGCATCGTCGACGACTGCGGAGGAGCCTTTATCATGGGCTGCGTTGGA
GGCGGGCTCTTTCAGGGACTGAAGGGATTCCGGAACGCACCACAGGGACT
AGGACGCAGGGTCGCCGGCAGTGTGGCTGCCATCAAGACCAAATCTCCGG
TGATAGGTGGAAGTTTCGCCGCCTGGGGTGCAGTGTTCAGCATTGTGGAC
TGCAGTCTGGTCCACTTTCGCCAAAAGGAGGATCCCTGGAACTCGATAGT
GAGCGGAGCAGTTACTGGTGGAATTCTGGCCTCACGCAATGGAGCGGCGG
CCATGGCTGGAAGTGCAATTATCGGTGGCGTACTGCTCTCAATGATCGAG
GGCTTAGGCATATTTTTTACACGTTTCGCGGCGGAACAGTTCCGAAATCG
TGAACCGCATATCATGCCTGATGCCAATGAAGGATACGGTGACTTCAACT
CTTCCGGATTTGGATTTCCGGGTGCTCAGCAGGCCACTGCAACTAGCTAA
ATTCCGATTTTTCTTGTCTGGGTATATTAATACGTAGTCCTTTTTGATTT
TCATAAGTGCTAGATTTAGCAATATTCCATTTGAAAAATTCGATGACAAT
AAAATATGGACAAAATTGCAGTAAAAAAAAAAAAAAAAAAAAAA

AT13511.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b2-RA 723 Tim17b2-RA 1..723 1..723 3585 99.7 Plus
Tim17b2-RB 1506 Tim17b2-RB 1..572 1..572 2830 99.6 Plus
CG1724-RA 843 CG1724-RA 130..521 70..461 640 77.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15483479..15484200 1..722 3610 100 Plus
chrX 22417052 chrX 21067978..21068369 461..70 640 77.6 Minus
chr3R 27901430 chr3R 8189664..8189749 371..286 190 81.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:47:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15484768..15485490 1..723 3585 99.7 Plus
X 23542271 X 21202821..21203212 461..70 640 77.6 Minus
3R 32079331 3R 12364287..12364372 371..286 190 81.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15484768..15485490 1..723 3585 99.7 Plus
X 23527363 X 21187913..21188304 461..70 640 77.5 Minus
3R 31820162 3R 12105118..12105203 371..286 190 81.3 Minus
Blast to na_te.dros performed on 2019-03-16 05:23:24 has no hits.

AT13511.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:24:27 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15483479..15484200 1..722 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:06 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:50 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:42:28 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:59:47 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:02:07 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:27 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..722 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:50 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..722 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:42:28 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 40..761 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:59:47 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 1..722 1..722 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:02:07 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b2-RA 40..761 1..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:27 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15484768..15485489 1..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:27 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15484768..15485489 1..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:27 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15484768..15485489 1..722 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:42:28 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15484768..15485489 1..722 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:13 Download gff for AT13511.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15484768..15485489 1..722 99   Plus

AT13511.pep Sequence

Translation from 69 to 599

> AT13511.pep
MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAG
SVAAIKTKSPVIGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTG
GILASRNGAAAMAGSAIIGGVLLSMIEGLGIFFTRFAAEQFRNREPHIMP
DANEGYGDFNSSGFGFPGAQQATATS*

AT13511.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15384-PA 181 GF15384-PA 1..181 1..176 695 73.5 Plus
Dana\GF20543-PA 171 GF20543-PA 1..146 1..146 601 71.9 Plus
Dana\GF18933-PA 184 GF18933-PA 1..146 1..146 525 61.6 Plus
Dana\GF16065-PA 224 GF16065-PA 2..140 3..140 453 61.2 Plus
Dana\GF15488-PA 206 GF15488-PA 2..148 3..147 385 51.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25162-PA 177 GG25162-PA 1..177 1..176 783 84.7 Plus
Dere\GG17552-PA 186 GG17552-PA 1..186 1..176 656 71 Plus
Dere\GG13145-PA 173 GG13145-PA 1..146 1..146 606 73.3 Plus
Dere\GG12726-PA 175 GG12726-PA 1..146 1..146 517 61 Plus
Dere\GG17140-PA 222 GG17140-PA 2..129 3..130 459 64.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13757-PA 172 GH13757-PA 1..164 1..166 618 66.9 Plus
Dgri\GH19590-PA 172 GH19590-PA 1..146 1..146 613 74.7 Plus
Dgri\GH17768-PA 185 GH17768-PA 1..143 1..143 509 64.3 Plus
Dgri\GH22709-PA 232 GH22709-PA 1..149 1..147 477 57.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b2-PC 176 CG15257-PC 1..176 1..176 924 100 Plus
Tim17b2-PA 176 CG15257-PA 1..176 1..176 924 100 Plus
CG1724-PA 185 CG1724-PA 1..185 1..176 686 73 Plus
Tim17b-PB 173 CG40451-PB 1..146 1..146 613 74 Plus
Tim17b-PA 173 CG40451-PA 1..146 1..146 613 74 Plus
Tim17b1-PA 179 CG1158-PA 1..146 1..146 516 60.3 Plus
Tim17a1-PB 222 CG10090-PB 2..129 3..130 459 64.8 Plus
Tim17a1-PA 222 CG10090-PA 2..129 3..130 459 64.8 Plus
Tim17a2-PA 224 CG14666-PA 2..129 3..130 437 61.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17897-PA 177 GI17897-PA 1..168 1..166 622 71.4 Plus
Dmoj\GI23631-PA 172 GI23631-PA 1..170 1..171 612 67.3 Plus
Dmoj\GI22546-PA 217 GI22546-PA 1..143 1..143 506 62.9 Plus
Dmoj\Tes127-PA 223 GI10214-PA 1..148 1..148 459 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12286-PA 173 GL12286-PA 1..170 1..171 616 67.8 Plus
Dper\GL26428-PA 171 GL26428-PA 1..161 1..160 581 66.5 Plus
Dper\GL14996-PA 191 GL14996-PA 2..145 3..150 427 54.1 Plus
Dper\GL22194-PA 202 GL22194-PA 2..145 3..146 414 52.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26255-PA 173 GA26255-PA 1..170 1..171 614 67.3 Plus
Dpse\GA28858-PA 171 GA28858-PA 1..158 1..158 585 68.4 Plus
Dpse\GA26353-PA 172 GA26353-PA 3..140 6..143 441 56.5 Plus
Dpse\GA22481-PA 191 GA22481-PA 2..145 3..146 432 54.9 Plus
Dpse\GA13158-PA 202 GA13158-PA 2..145 3..146 415 52.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16089-PA 478 GM16089-PA 1..172 1..171 838 93.6 Plus
Dsec\GM22636-PA 185 GM22636-PA 1..184 1..175 669 72.3 Plus
Dsec\GM23215-PA 173 GM23215-PA 1..146 1..146 611 74 Plus
Dsec\GM10800-PA 179 GM10800-PA 1..146 1..146 502 59.6 Plus
Dsec\GM26023-PA 222 GM26023-PA 2..129 3..130 468 65.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24009-PA 420 GD24009-PA 1..172 1..171 831 93 Plus
Dsim\GD24434-PA 185 GD24434-PA 1..185 1..176 682 73.5 Plus
Dsim\GD19775-PA 179 GD19775-PA 1..146 1..146 501 59.6 Plus
Dsim\GD11957-PA 119 GD11957-PA 1..111 1..111 477 73.9 Plus
Dsim\GD20580-PA 222 GD20580-PA 2..129 3..130 469 65.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17402-PA 177 GJ17402-PA 1..177 1..176 620 67.6 Plus
Dvir\GJ11192-PA 172 GJ11192-PA 1..146 1..146 603 73.3 Plus
Dvir\GJ10150-PA 189 GJ10150-PA 1..142 1..143 489 63.6 Plus
Dvir\GJ11015-PA 224 GJ11015-PA 1..140 1..140 461 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12238-PA 173 GK12238-PA 1..171 1..171 610 67.3 Plus
Dwil\GK18250-PA 179 GK18250-PA 1..163 1..159 607 68.7 Plus
Dwil\GK12968-PA 180 GK12968-PA 1..142 1..142 508 62.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21001-PA 177 GE21001-PA 1..177 1..176 795 87 Plus
Dyak\GE15312-PA 185 GE15312-PA 1..185 1..176 687 73.5 Plus
Dyak\GE25459-PA 179 GE25459-PA 1..154 1..154 512 59.1 Plus
Dyak\GE24530-PA 222 GE24530-PA 2..129 3..130 456 64.1 Plus

AT13511.hyp Sequence

Translation from 69 to 599

> AT13511.hyp
MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAG
SVAAIKTKSPVIGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTG
GILASRNGAAAMAGSAIIGGVLLSMIEGLGIFFTRFAAEQFRNREPHIMP
DANEGYGDFNSSGFGFPGAQQATATS*

AT13511.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b2-PC 176 CG15257-PC 1..176 1..176 924 100 Plus
Tim17b2-PA 176 CG15257-PA 1..176 1..176 924 100 Plus
CG1724-PA 185 CG1724-PA 1..185 1..176 686 73 Plus
Tim17b-PB 173 CG40451-PB 1..146 1..146 613 74 Plus
Tim17b-PA 173 CG40451-PA 1..146 1..146 613 74 Plus