BDGP Sequence Production Resources |
Search the DGRC for AT13539
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 135 |
Well: | 39 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG11885-RA |
Protein status: | AT13539.pep: gold |
Preliminary Size: | 426 |
Sequenced Size: | 544 |
Gene | Date | Evidence |
---|---|---|
CG11885 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11885 | 2002-01-11 | Blastp of sequenced clone |
CG11885 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11885 | 2008-04-29 | Release 5.5 accounting |
CG11885 | 2008-08-15 | Release 5.9 accounting |
CG11885 | 2008-12-18 | 5.12 accounting |
544 bp (544 high quality bases) assembled on 2002-01-11
GenBank Submission: AY075193
> AT13539.complete CAATATCAACATTGTTAAACGCTTTTAAATTCTCTCAAAAAATGAATCAC ACAGCAAACAAACCTCGACAAATCGGATTCGACAGGCAGTTCTCAGCGGA CGTGAACGGCGTTCCCACGGAGATAGTGTTCCACTGCTTTGCCAAGAAGT GGTTCTTAGTCATAACGCAGCTCGGCAAGATTCCCGGCATCTACAACGTG CACTTCGATGTCAAAAAGGACGAAAGAGTGGTTCCCTATTTGCACGGACC CGTGGACAATCCGGAGTTCCACGTATCGGTGCCAATCACGATGAACTGCT GCTTGGGCTTGGACACCGACGAGACTCGCAGCGCCATACAGTTTCTGGTC AACAGAACCGGACTCCACAAGTGCCCGACGGAGTTCGTGGTGGGCCTGGG TCTCAAGAAAATCGACGGACCCAATCTTCGTGCCCTAGCTAAGGTCCTCG AGGAGACGTTATTCTAGTCTGCGTTCGTTATATCCAATAAATATTAGCTG TGACAGTTTTTGTAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11885-RA | 521 | CG11885-RA | 1..521 | 1..521 | 2560 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 420902..421418 | 517..1 | 2570 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 420887..421407 | 521..1 | 2560 | 99.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 420887..421407 | 521..1 | 2560 | 99.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 420901..421418 | 1..518 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..426 | 42..467 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..426 | 42..467 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..426 | 42..467 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..426 | 42..467 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..426 | 42..467 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..517 | 1..518 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..517 | 1..518 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 44..556 | 1..513 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 1..517 | 1..518 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11885-RA | 44..556 | 1..513 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 420890..421407 | 1..518 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 420890..421407 | 1..518 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 420890..421407 | 1..518 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 420890..421407 | 1..518 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 420890..421407 | 1..518 | 99 | Minus |
Translation from 2 to 466
> AT13539.hyp ISTLLNAFKFSQKMNHTANKPRQIGFDRQFSADVNGVPTEIVFHCFAKKW FLVITQLGKIPGIYNVHFDVKKDERVVPYLHGPVDNPEFHVSVPITMNCC LGLDTDETRSAIQFLVNRTGLHKCPTEFVVGLGLKKIDGPNLRALAKVLE ETLF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11885-PA | 141 | CG11885-PA | 1..141 | 14..154 | 758 | 100 | Plus |
Translation from 41 to 466
> AT13539.pep MNHTANKPRQIGFDRQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGI YNVHFDVKKDERVVPYLHGPVDNPEFHVSVPITMNCCLGLDTDETRSAIQ FLVNRTGLHKCPTEFVVGLGLKKIDGPNLRALAKVLEETLF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24784-PA | 139 | GF24784-PA | 2..139 | 4..141 | 594 | 79.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24649-PA | 141 | GG24649-PA | 1..141 | 1..141 | 691 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10518-PA | 143 | GH10518-PA | 7..143 | 5..141 | 480 | 62.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11885-PA | 141 | CG11885-PA | 1..141 | 1..141 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18035-PA | 141 | GI18035-PA | 1..141 | 1..141 | 476 | 58.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19263-PA | 147 | GL19263-PA | 19..147 | 9..141 | 394 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11259-PA | 147 | GA11259-PA | 19..147 | 9..141 | 394 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16669-PA | 141 | GM16669-PA | 1..141 | 1..141 | 737 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22958-PA | 141 | GD22958-PA | 1..141 | 1..141 | 737 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19739-PA | 141 | GJ19739-PA | 1..141 | 1..141 | 488 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24410-PA | 137 | GK24410-PA | 5..137 | 6..141 | 511 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16117-PA | 141 | GE16117-PA | 1..141 | 1..141 | 698 | 91.5 | Plus |