Clone AT13539 Report

Search the DGRC for AT13539

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:135
Well:39
Vector:pOTB7
Associated Gene/TranscriptCG11885-RA
Protein status:AT13539.pep: gold
Preliminary Size:426
Sequenced Size:544

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11885 2002-01-01 Sim4 clustering to Release 2
CG11885 2002-01-11 Blastp of sequenced clone
CG11885 2003-01-01 Sim4 clustering to Release 3
CG11885 2008-04-29 Release 5.5 accounting
CG11885 2008-08-15 Release 5.9 accounting
CG11885 2008-12-18 5.12 accounting

Clone Sequence Records

AT13539.complete Sequence

544 bp (544 high quality bases) assembled on 2002-01-11

GenBank Submission: AY075193

> AT13539.complete
CAATATCAACATTGTTAAACGCTTTTAAATTCTCTCAAAAAATGAATCAC
ACAGCAAACAAACCTCGACAAATCGGATTCGACAGGCAGTTCTCAGCGGA
CGTGAACGGCGTTCCCACGGAGATAGTGTTCCACTGCTTTGCCAAGAAGT
GGTTCTTAGTCATAACGCAGCTCGGCAAGATTCCCGGCATCTACAACGTG
CACTTCGATGTCAAAAAGGACGAAAGAGTGGTTCCCTATTTGCACGGACC
CGTGGACAATCCGGAGTTCCACGTATCGGTGCCAATCACGATGAACTGCT
GCTTGGGCTTGGACACCGACGAGACTCGCAGCGCCATACAGTTTCTGGTC
AACAGAACCGGACTCCACAAGTGCCCGACGGAGTTCGTGGTGGGCCTGGG
TCTCAAGAAAATCGACGGACCCAATCTTCGTGCCCTAGCTAAGGTCCTCG
AGGAGACGTTATTCTAGTCTGCGTTCGTTATATCCAATAAATATTAGCTG
TGACAGTTTTTGTAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA

AT13539.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11885-RA 521 CG11885-RA 1..521 1..521 2560 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 420902..421418 517..1 2570 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 420887..421407 521..1 2560 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 420887..421407 521..1 2560 99.4 Minus
Blast to na_te.dros performed on 2019-03-15 15:18:13 has no hits.

AT13539.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:19:14 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 420901..421418 1..518 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:07 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..426 42..467 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:03 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..426 42..467 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:22:50 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..426 42..467 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:02 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..426 42..467 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:50 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..426 42..467 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:23 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..517 1..518 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:03 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..517 1..518 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:22:50 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 44..556 1..513 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:02 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 1..517 1..518 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:50 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
CG11885-RA 44..556 1..513 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:14 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
2L 420890..421407 1..518 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:14 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
2L 420890..421407 1..518 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:14 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
2L 420890..421407 1..518 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:22:50 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 420890..421407 1..518 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:42 Download gff for AT13539.complete
Subject Subject Range Query Range Percent Splice Strand
2L 420890..421407 1..518 99   Minus

AT13539.hyp Sequence

Translation from 2 to 466

> AT13539.hyp
ISTLLNAFKFSQKMNHTANKPRQIGFDRQFSADVNGVPTEIVFHCFAKKW
FLVITQLGKIPGIYNVHFDVKKDERVVPYLHGPVDNPEFHVSVPITMNCC
LGLDTDETRSAIQFLVNRTGLHKCPTEFVVGLGLKKIDGPNLRALAKVLE
ETLF*

AT13539.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11885-PA 141 CG11885-PA 1..141 14..154 758 100 Plus

AT13539.pep Sequence

Translation from 41 to 466

> AT13539.pep
MNHTANKPRQIGFDRQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGI
YNVHFDVKKDERVVPYLHGPVDNPEFHVSVPITMNCCLGLDTDETRSAIQ
FLVNRTGLHKCPTEFVVGLGLKKIDGPNLRALAKVLEETLF*

AT13539.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24784-PA 139 GF24784-PA 2..139 4..141 594 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24649-PA 141 GG24649-PA 1..141 1..141 691 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10518-PA 143 GH10518-PA 7..143 5..141 480 62.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11885-PA 141 CG11885-PA 1..141 1..141 758 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18035-PA 141 GI18035-PA 1..141 1..141 476 58.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19263-PA 147 GL19263-PA 19..147 9..141 394 58.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11259-PA 147 GA11259-PA 19..147 9..141 394 58.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16669-PA 141 GM16669-PA 1..141 1..141 737 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22958-PA 141 GD22958-PA 1..141 1..141 737 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19739-PA 141 GJ19739-PA 1..141 1..141 488 59.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24410-PA 137 GK24410-PA 5..137 6..141 511 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16117-PA 141 GE16117-PA 1..141 1..141 698 91.5 Plus