Clone AT13707 Report

Search the DGRC for AT13707

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:137
Well:7
Vector:pOTB7
Associated Gene/TranscriptCG42336-RC
Protein status:AT13707.pep: gold
Preliminary Size:807
Sequenced Size:750

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13211 2002-01-01 Sim4 clustering to Release 2
CG13211 2002-04-26 Blastp of sequenced clone
CG13211 2003-01-01 Sim4 clustering to Release 3
CG13211 2008-04-29 Release 5.5 accounting
CG42336 2008-08-15 Release 5.9 accounting
CG42336 2008-12-18 5.12 accounting

Clone Sequence Records

AT13707.complete Sequence

750 bp (750 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113250

> AT13707.complete
CGAGCCACAGCTAGAATGTTTGCTTCGTTTAAAAGCGTTCGATTTTTGAT
AAGATAACCAGTGGTAAGCGTAGGATCCACCGCAGACATAGGTAGAGTGG
AATCCAAAGAGCAGTATTTGCCAGAGACCCATGCCGGGCTGTAGTTGACA
CACCACTTAGCCCCTTTTCCGAACAACCCAAAACATGAGTTGGTCGGGTT
CCAGTGACGAGCTCGGGGTTATTGAGCAGCTGAAAAAGTCCGTGGAGTCG
ATCGTGGCCAAAACTGGGCCCAGCAGCAAGTTCTCCAAGGATCTCGTCCA
GCGGATCGGCGAGATGCAGAGCAAGCTGGAGTCCCTGGCCGAAACGGATC
GGCATGTGTTTCTCGCCGAGATGAAGGACAAGTTCCAGCAGACGATTGGC
AGAATCGAGGAGCGAATAGTGCAGCACGCCCATTTCGCACAGACCTACTC
CAGTTCCATAGTGTCGGCAGTGATCTTTCTCTTGGTCTCCATATTCGCTC
TCTTTGGCTACAAGCTGTACAAATCCCTGACGGAAAAGGAGCTCAAGAAG
CAGGAGAAACTGAAGAGCAAGCAACAGAAGAAGGCCAAGAAGTCAAACTG
AAGGAGATGGAGGCGAGGATATCATTGACGTAGTGCACTTTCCGGCCCTG
AGACCTTCCATCTTGTTAATCAATACAATCGCCCTGTAAATGACTAAATC
ATAAACCAGTAAACGTAATAAAATAAAACGTAAAAAAAAAAAAAAAAAAA

AT13707.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RC 747 CG42336-RC 1..732 1..732 3660 100 Plus
CG42336.a 734 CG42336.a 1..489 1..489 2430 99.7 Plus
CG42336-RD 635 CG42336-RD 1..318 185..502 1575 99.6 Plus
CG42336.a 734 CG42336.a 484..719 497..732 1180 100 Plus
CG42336-RD 635 CG42336-RD 385..620 497..732 1180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7182294..7182795 502..1 2480 99.6 Minus
chr2R 21145070 chr2R 7181993..7182227 731..497 1175 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294853..11295354 502..1 2495 99.8 Minus
2R 25286936 2R 11294551..11294786 732..497 1180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11296052..11296553 502..1 2495 99.8 Minus
2R 25260384 2R 11295750..11295985 732..497 1180 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:34:57 has no hits.

AT13707.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:35:45 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7181993..7182226 498..731 100 <- Minus
chr2R 7182299..7182795 1..497 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:34 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 185..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:53 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 185..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:42:51 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 185..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:46 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 185..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:55 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 185..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:53 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..731 1..731 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:53 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..731 1..731 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:42:51 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..731 1..731 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:47 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..731 1..731 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:55 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..731 1..731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:45 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294552..11294785 498..731 100 <- Minus
2R 11294858..11295354 1..497 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:45 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294552..11294785 498..731 100 <- Minus
2R 11294858..11295354 1..497 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:45 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294552..11294785 498..731 100 <- Minus
2R 11294858..11295354 1..497 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:42:51 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7182057..7182290 498..731 100 <- Minus
arm_2R 7182363..7182859 1..497 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:34:27 Download gff for AT13707.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11295751..11295984 498..731 100 <- Minus
2R 11296057..11296553 1..497 100   Minus

AT13707.hyp Sequence

Translation from 184 to 600

> AT13707.hyp
MSWSGSSDELGVIEQLKKSVESIVAKTGPSSKFSKDLVQRIGEMQSKLES
LAETDRHVFLAEMKDKFQQTIGRIEERIVQHAHFAQTYSSSIVSAVIFLL
VSIFALFGYKLYKSLTEKELKKQEKLKSKQQKKAKKSN*

AT13707.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-PC 138 CG13211-PB 1..138 1..138 673 100 Plus
CG42336-PD 162 CG42336-PD 1..162 1..138 638 85.2 Plus
CG42336-PF 140 CG42336-PF 37..140 33..138 191 45.4 Plus
CG42336-PE 140 CG42336-PE 37..140 33..138 191 45.4 Plus
CG42336-PB 65 CG13211-PA 22..65 92..138 170 78.7 Plus

AT13707.pep Sequence

Translation from 184 to 600

> AT13707.pep
MSWSGSSDELGVIEQLKKSVESIVAKTGPSSKFSKDLVQRIGEMQSKLES
LAETDRHVFLAEMKDKFQQTIGRIEERIVQHAHFAQTYSSSIVSAVIFLL
VSIFALFGYKLYKSLTEKELKKQEKLKSKQQKKAKKSN*

AT13707.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12414-PA 138 GF12414-PA 1..116 1..116 512 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22673-PA 138 GG22673-PA 1..138 1..138 597 93.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21930-PA 134 GH21930-PA 3..112 6..116 397 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-PC 138 CG13211-PB 1..138 1..138 673 100 Plus
CG42336-PD 162 CG42336-PD 1..162 1..138 638 85.2 Plus
CG42336-PF 140 CG42336-PF 37..140 33..138 191 45.4 Plus
CG42336-PE 140 CG42336-PE 37..140 33..138 191 45.4 Plus
CG42336-PB 65 CG13211-PA 22..65 92..138 170 78.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19638-PA 134 GI19638-PA 2..123 5..127 427 64.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16739-PA 138 GL16739-PA 1..116 1..116 452 73.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30481-PB 138 GA30481-PB 1..116 1..116 453 73.3 Plus
Dpse\GA30481-PC 162 GA30481-PC 1..140 1..116 419 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20451-PA 138 GM20451-PA 1..138 1..138 671 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25919-PA 138 GD25919-PA 1..138 1..138 679 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15004-PA 134 GJ15004-PA 2..111 6..115 383 64.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21617-PA 139 GK21617-PA 4..117 2..116 410 65.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13028-PA 138 GE13028-PA 1..138 1..138 673 97.1 Plus