Clone AT13736 Report

Search the DGRC for AT13736

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:137
Well:36
Vector:pOTB7
Associated Gene/TranscriptCG7580-RA
Protein status:AT13736.pep: gold
Preliminary Size:383
Sequenced Size:672

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7580 2002-01-01 Sim4 clustering to Release 2
CG7580 2002-04-21 Blastp of sequenced clone
CG7580 2003-01-01 Sim4 clustering to Release 3
CG7580 2008-04-29 Release 5.5 accounting
CG7580 2008-08-15 Release 5.9 accounting
CG7580 2008-12-18 5.12 accounting

Clone Sequence Records

AT13736.complete Sequence

672 bp (672 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113252

> AT13736.complete
ATTTGAATAAATATAATCTTTTCGTTCACGAAATTTAAGTTTTTAAGCCG
CTCACATATTTTATTACGGCAAAGTTTAAAGATCCGCTATCCACACAAAT
TAGGTTCAAGTCCACGCTGAAAGTCTACAAAGTTACACATTCTGGTGGTG
GCCTGCACTAAGCTTCTGTCCAAGACATCAATCTTAAAAAGCGGCACTTT
TAGGACATTTTTCAAAAATAAAGCCTAACTGCTTGGTATGTTCAAGCGGC
CCGTCCACGGTCACACTGGTTGAGACGAGTCGAGAGGAAATTGCAGCGTA
AAAGTCGAATTTCAAGCCCCACAACCATGCGTCTATCCTCGATCCTGAAT
GGCCAGCATTTTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAA
GCTGTCGCCCTTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGAC
TGCCCAACATGGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCC
CCCTTCATCGTGGGATACCTGATCTACGATCTGACCGAACGCAAGCACAC
CGCCCTGCTGCGCAAGAACCCCGCTGACTACGCGAACGACGAATAAGCGT
CCCAACTAGCAGATAGTTATGTTAAACTAATTAATAAAACTAAACCCACA
GTTCAAAAAAAAAAAAAAAAAA

AT13736.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-RA 816 CG7580-RA 39..694 1..656 3265 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17464412..17464655 73..316 1220 100 Plus
chr3L 24539361 chr3L 17464928..17465114 315..501 935 100 Plus
chr3L 24539361 chr3L 17465171..17465323 502..654 765 100 Plus
chr3L 24539361 chr3L 17464281..17464354 1..74 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17474892..17475135 73..316 1205 99.6 Plus
3L 28110227 3L 17475408..17475594 315..501 935 100 Plus
3L 28110227 3L 17475651..17475805 502..656 775 100 Plus
3L 28110227 3L 17474761..17474834 1..74 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17467992..17468235 73..316 1205 99.5 Plus
3L 28103327 3L 17468508..17468694 315..501 935 100 Plus
3L 28103327 3L 17468751..17468905 502..656 775 100 Plus
3L 28103327 3L 17467861..17467934 1..74 370 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:51:51 has no hits.

AT13736.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:28 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17465171..17465323 502..654 100   Plus
chr3L 17464281..17464354 1..74 100 -> Plus
chr3L 17464414..17464655 75..316 100 -> Plus
chr3L 17464930..17465114 317..501 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:37 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..270 327..596 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:36 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RC 1..270 327..596 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:48:37 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 1..270 327..596 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:04 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..270 327..596 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:46:16 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 1..270 327..596 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:54 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..654 1..654 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:35 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..654 1..654 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:48:37 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..654 1..654 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:04 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..654 1..654 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:46:16 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..654 1..654 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:28 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17474761..17474834 1..74 100 -> Plus
3L 17474894..17475135 75..316 99 -> Plus
3L 17475410..17475594 317..501 100 -> Plus
3L 17475651..17475803 502..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:28 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17474761..17474834 1..74 100 -> Plus
3L 17474894..17475135 75..316 99 -> Plus
3L 17475410..17475594 317..501 100 -> Plus
3L 17475651..17475803 502..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:28 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17474761..17474834 1..74 100 -> Plus
3L 17474894..17475135 75..316 99 -> Plus
3L 17475410..17475594 317..501 100 -> Plus
3L 17475651..17475803 502..654 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:48:37 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17467994..17468235 75..316 99 -> Plus
arm_3L 17468510..17468694 317..501 100 -> Plus
arm_3L 17468751..17468903 502..654 100   Plus
arm_3L 17467861..17467934 1..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:37 Download gff for AT13736.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17467994..17468235 75..316 99 -> Plus
3L 17468510..17468694 317..501 100 -> Plus
3L 17468751..17468903 502..654 100   Plus
3L 17467861..17467934 1..74 100 -> Plus

AT13736.hyp Sequence

Translation from 326 to 595

> AT13736.hyp
MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR
SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDE*

AT13736.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-PD 89 CG7580-PD 1..89 1..89 460 100 Plus
CG7580-PC 89 CG7580-PC 1..89 1..89 460 100 Plus
CG7580-PB 89 CG7580-PB 1..89 1..89 460 100 Plus
CG7580-PA 89 CG7580-PA 1..89 1..89 460 100 Plus

AT13736.pep Sequence

Translation from 326 to 595

> AT13736.pep
MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR
SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDE*

AT13736.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10534-PA 89 GF10534-PA 1..89 1..89 438 91 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13618-PA 89 GG13618-PA 1..89 1..89 464 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16188-PA 89 GH16188-PA 1..89 1..89 425 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-Q-PD 89 CG7580-PD 1..89 1..89 460 100 Plus
UQCR-Q-PC 89 CG7580-PC 1..89 1..89 460 100 Plus
UQCR-Q-PB 89 CG7580-PB 1..89 1..89 460 100 Plus
UQCR-Q-PA 89 CG7580-PA 1..89 1..89 460 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13339-PA 89 GI13339-PA 1..89 1..89 412 86.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15585-PA 89 GL15585-PA 1..89 1..89 432 87.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20453-PA 89 GA20453-PA 1..89 1..89 438 91 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25702-PA 89 GM25702-PA 1..89 1..89 469 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14709-PA 89 GD14709-PA 1..89 1..89 469 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13165-PA 89 GJ13165-PA 1..89 1..89 417 87.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17744-PA 89 GK17744-PA 1..89 1..89 430 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19914-PA 89 GE19914-PA 1..89 1..89 466 98.9 Plus