BDGP Sequence Production Resources |
Search the DGRC for AT13736
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 137 |
Well: | 36 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG7580-RA |
Protein status: | AT13736.pep: gold |
Preliminary Size: | 383 |
Sequenced Size: | 672 |
Gene | Date | Evidence |
---|---|---|
CG7580 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7580 | 2002-04-21 | Blastp of sequenced clone |
CG7580 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7580 | 2008-04-29 | Release 5.5 accounting |
CG7580 | 2008-08-15 | Release 5.9 accounting |
CG7580 | 2008-12-18 | 5.12 accounting |
672 bp (672 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113252
> AT13736.complete ATTTGAATAAATATAATCTTTTCGTTCACGAAATTTAAGTTTTTAAGCCG CTCACATATTTTATTACGGCAAAGTTTAAAGATCCGCTATCCACACAAAT TAGGTTCAAGTCCACGCTGAAAGTCTACAAAGTTACACATTCTGGTGGTG GCCTGCACTAAGCTTCTGTCCAAGACATCAATCTTAAAAAGCGGCACTTT TAGGACATTTTTCAAAAATAAAGCCTAACTGCTTGGTATGTTCAAGCGGC CCGTCCACGGTCACACTGGTTGAGACGAGTCGAGAGGAAATTGCAGCGTA AAAGTCGAATTTCAAGCCCCACAACCATGCGTCTATCCTCGATCCTGAAT GGCCAGCATTTTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAA GCTGTCGCCCTTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGAC TGCCCAACATGGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCC CCCTTCATCGTGGGATACCTGATCTACGATCTGACCGAACGCAAGCACAC CGCCCTGCTGCGCAAGAACCCCGCTGACTACGCGAACGACGAATAAGCGT CCCAACTAGCAGATAGTTATGTTAAACTAATTAATAAAACTAAACCCACA GTTCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7580-RA | 816 | CG7580-RA | 39..694 | 1..656 | 3265 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 17464412..17464655 | 73..316 | 1220 | 100 | Plus |
chr3L | 24539361 | chr3L | 17464928..17465114 | 315..501 | 935 | 100 | Plus |
chr3L | 24539361 | chr3L | 17465171..17465323 | 502..654 | 765 | 100 | Plus |
chr3L | 24539361 | chr3L | 17464281..17464354 | 1..74 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 17474892..17475135 | 73..316 | 1205 | 99.6 | Plus |
3L | 28110227 | 3L | 17475408..17475594 | 315..501 | 935 | 100 | Plus |
3L | 28110227 | 3L | 17475651..17475805 | 502..656 | 775 | 100 | Plus |
3L | 28110227 | 3L | 17474761..17474834 | 1..74 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 17467992..17468235 | 73..316 | 1205 | 99.5 | Plus |
3L | 28103327 | 3L | 17468508..17468694 | 315..501 | 935 | 100 | Plus |
3L | 28103327 | 3L | 17468751..17468905 | 502..656 | 775 | 100 | Plus |
3L | 28103327 | 3L | 17467861..17467934 | 1..74 | 370 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 17465171..17465323 | 502..654 | 100 | Plus | |
chr3L | 17464281..17464354 | 1..74 | 100 | -> | Plus |
chr3L | 17464414..17464655 | 75..316 | 100 | -> | Plus |
chr3L | 17464930..17465114 | 317..501 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..270 | 327..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RC | 1..270 | 327..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RB | 1..270 | 327..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..270 | 327..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RB | 1..270 | 327..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..654 | 1..654 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..654 | 1..654 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..654 | 1..654 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..654 | 1..654 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7580-RA | 1..654 | 1..654 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17474761..17474834 | 1..74 | 100 | -> | Plus |
3L | 17474894..17475135 | 75..316 | 99 | -> | Plus |
3L | 17475410..17475594 | 317..501 | 100 | -> | Plus |
3L | 17475651..17475803 | 502..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17474761..17474834 | 1..74 | 100 | -> | Plus |
3L | 17474894..17475135 | 75..316 | 99 | -> | Plus |
3L | 17475410..17475594 | 317..501 | 100 | -> | Plus |
3L | 17475651..17475803 | 502..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17474761..17474834 | 1..74 | 100 | -> | Plus |
3L | 17474894..17475135 | 75..316 | 99 | -> | Plus |
3L | 17475410..17475594 | 317..501 | 100 | -> | Plus |
3L | 17475651..17475803 | 502..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 17467994..17468235 | 75..316 | 99 | -> | Plus |
arm_3L | 17468510..17468694 | 317..501 | 100 | -> | Plus |
arm_3L | 17468751..17468903 | 502..654 | 100 | Plus | |
arm_3L | 17467861..17467934 | 1..74 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17467994..17468235 | 75..316 | 99 | -> | Plus |
3L | 17468510..17468694 | 317..501 | 100 | -> | Plus |
3L | 17468751..17468903 | 502..654 | 100 | Plus | |
3L | 17467861..17467934 | 1..74 | 100 | -> | Plus |
Translation from 326 to 595
> AT13736.hyp MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7580-PD | 89 | CG7580-PD | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PC | 89 | CG7580-PC | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PB | 89 | CG7580-PB | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PA | 89 | CG7580-PA | 1..89 | 1..89 | 460 | 100 | Plus |
Translation from 326 to 595
> AT13736.pep MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10534-PA | 89 | GF10534-PA | 1..89 | 1..89 | 438 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13618-PA | 89 | GG13618-PA | 1..89 | 1..89 | 464 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16188-PA | 89 | GH16188-PA | 1..89 | 1..89 | 425 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
UQCR-Q-PD | 89 | CG7580-PD | 1..89 | 1..89 | 460 | 100 | Plus |
UQCR-Q-PC | 89 | CG7580-PC | 1..89 | 1..89 | 460 | 100 | Plus |
UQCR-Q-PB | 89 | CG7580-PB | 1..89 | 1..89 | 460 | 100 | Plus |
UQCR-Q-PA | 89 | CG7580-PA | 1..89 | 1..89 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13339-PA | 89 | GI13339-PA | 1..89 | 1..89 | 412 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15585-PA | 89 | GL15585-PA | 1..89 | 1..89 | 432 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20453-PA | 89 | GA20453-PA | 1..89 | 1..89 | 438 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25702-PA | 89 | GM25702-PA | 1..89 | 1..89 | 469 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14709-PA | 89 | GD14709-PA | 1..89 | 1..89 | 469 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13165-PA | 89 | GJ13165-PA | 1..89 | 1..89 | 417 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17744-PA | 89 | GK17744-PA | 1..89 | 1..89 | 430 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19914-PA | 89 | GE19914-PA | 1..89 | 1..89 | 466 | 98.9 | Plus |