Clone AT13777 Report

Search the DGRC for AT13777

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:137
Well:77
Vector:pOTB7
Associated Gene/TranscriptCG12861-RA
Protein status:AT13777.pep: gold
Preliminary Size:1080
Sequenced Size:1093

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12861 2002-01-01 Sim4 clustering to Release 2
CG12861 2002-02-22 Blastp of sequenced clone
CG12861 2003-01-01 Sim4 clustering to Release 3
CG12861 2008-04-29 Release 5.5 accounting
CG12861 2008-08-15 Release 5.9 accounting
CG12861 2008-12-18 5.12 accounting

Clone Sequence Records

AT13777.complete Sequence

1093 bp (1093 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089331

> AT13777.complete
AAACAGTTGTTCGAGTGGTAAACACACATAACACCTTAGCCTCCCCAAAA
ATCCAGGTTTCCGTTTTGGTTTCCTTTCAAAATTCCAGTTAAATTCAGTT
AGAATGGGGGTGTTGCAGACAGTCCAACGAACGCTGTTGATGCAGCACAG
CTTGGGATCGCTGACGATCAAGCGCACATACGACACGGTAAAAAAGATGA
ATCTGCGTCGCAGGCGTTTGGAGCATCTAAAAGAACTCAAGCGGCTAGAC
GAAATGTGCTACAAGGCGGCCAGTCGCAACGATAAGAAGTGCCATCCGCC
AGTGCTACCACTACCCAAGATGGAGTGCATAGACGACCCATGTGCGGAAT
CAGAGATGCCATTGGATCTGGACCACTATACTCCGAGCGACAAGGCCGCG
CGCAAATATCAACGCACCTGGTGCGAGTGCTATATGATACCCAAGGCGGC
TGTCAAGGCCAGGAAATGCTATCCGAATAGACCGCGGCGTAAGTTCGAGT
GTCCGAGGGTCTCTGATGTCGAGTGCCGCTGGGATCCCATGCCCTGTGAT
GACGTGAAGAAAAAGCCCGAGATACTGATTGAAGTGCCGCGTATCGGGAA
GTGGCCATGCTGCAAGATCCCCACGCCAGGTTGCCGCGATGGCCGGATAC
CGCCATCCTGCGACGCTGGTCGAATTCCCACCTGCTGCAAGAAGCGTCGC
ACCAAGTATCCCAGCTTCTCGGAGTGCAAAAAGGAACTGCTCGACCCCAT
CCCACCATGCGAGTGCGAGAAGAAGGTTAACATGTGCGACGTGTATGCAT
ATTTCCGCCATAAGACACACTAACTTCGGTCCCTGAAAGAGCTTGGAAAT
CAAGGCGGTATAAGAAGCCCACCTGGATGATGAAGTCACAAAATTGGCTA
GCGTGTATTGCTGTTCATTGTTATGGGTTCATTTACAAAAGTTTGACCCT
TTAGCCCTTGCCGCCTTTTACCAATCCTGATTACCCATTTTAAAAGGTGA
CAAATTCAAAAATTTCCATTTCAAATATAGCTTGGATGTTGTTGCTACCG
ACATTAAATTGATTTCACAAATTAAAAAAAAAAAAAAAAAAAA

AT13777.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12861-RA 1106 CG12861-RA 1..1038 1..1034 4915 98.5 Plus
CG12861-RA 1106 CG12861-RA 1059..1101 1032..1074 215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10551620..10552657 1034..1 5000 99.2 Minus
chr2R 21145070 chr2R 10551558..10551599 1073..1032 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14664314..14665351 1034..1 4895 98.6 Minus
2R 25286936 2R 14664251..14664293 1074..1032 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14665513..14666550 1034..1 4915 98.5 Minus
2R 25260384 2R 14665450..14665492 1074..1032 215 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:30:11 has no hits.

AT13777.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:30:54 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10551558..10551601 1031..1073 95 -> Minus
chr2R 10551624..10552657 1..1030 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:04:45 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..720 104..823 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:45 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..720 104..823 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:24 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..720 104..823 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:52 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..720 104..823 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:51 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..720 104..823 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:34 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..1034 1..1030 98 <- Plus
CG12861-RA 1057..1100 1031..1073 95   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:45 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..1034 1..1030 98 <- Plus
CG12861-RA 1057..1100 1031..1073 95   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:24 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 6..1039 1..1030 98 <- Plus
CG12861-RA 1062..1105 1031..1073 95   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:52 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 1..1034 1..1030 98 <- Plus
CG12861-RA 1057..1100 1031..1073 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:51 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12861-RA 6..1039 1..1030 98 <- Plus
CG12861-RA 1062..1105 1031..1073 95   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:54 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14664252..14664295 1031..1073 95 -> Minus
2R 14664318..14665351 1..1030 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:54 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14664252..14664295 1031..1073 95 -> Minus
2R 14664318..14665351 1..1030 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:54 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14664252..14664295 1031..1073 95 -> Minus
2R 14664318..14665351 1..1030 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:24 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10551757..10551800 1031..1073 95 -> Minus
arm_2R 10551823..10552856 1..1030 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:13 Download gff for AT13777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14665517..14666550 1..1030 98   Minus
2R 14665451..14665494 1031..1073 95 -> Minus

AT13777.pep Sequence

Translation from 103 to 822

> AT13777.pep
MGVLQTVQRTLLMQHSLGSLTIKRTYDTVKKMNLRRRRLEHLKELKRLDE
MCYKAASRNDKKCHPPVLPLPKMECIDDPCAESEMPLDLDHYTPSDKAAR
KYQRTWCECYMIPKAAVKARKCYPNRPRRKFECPRVSDVECRWDPMPCDD
VKKKPEILIEVPRIGKWPCCKIPTPGCRDGRIPPSCDAGRIPTCCKKRRT
KYPSFSECKKELLDPIPPCECEKKVNMCDVYAYFRHKTH*

AT13777.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13522-PA 226 GF13522-PA 1..225 1..239 493 48.4 Plus
Dana\GF12592-PA 303 GF12592-PA 112..290 36..238 170 32.9 Plus
Dana\GF14894-PA 253 GF14894-PA 52..249 44..238 167 31 Plus
Dana\GF19807-PA 244 GF19807-PA 38..242 42..237 148 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22409-PA 239 GG22409-PA 1..238 1..238 1189 94.5 Plus
Dere\GG10650-PA 256 GG10650-PA 38..254 27..237 228 34.1 Plus
Dere\GG10647-PA 303 GG10647-PA 146..289 88..237 163 38.5 Plus
Dere\GG25129-PA 248 GG25129-PA 14..246 11..237 156 30.4 Plus
Dere\GG10654-PA 291 GG10654-PA 131..278 87..239 151 35.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20818-PA 177 GH20818-PA 9..175 72..237 200 34.3 Plus
Dgri\GH20817-PA 240 GH20817-PA 89..226 84..237 152 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG12861-PA 239 CG12861-PA 1..239 1..239 1351 100 Plus
boly-PA 255 CG30362-PA 64..253 50..237 255 33.5 Plus
CG4691-PA 262 CG4691-PA 52..260 34..237 245 31.7 Plus
CG2127-PB 289 CG2127-PB 116..275 74..237 230 36 Plus
CG2127-PA 305 CG2127-PA 132..291 74..237 230 36 Plus
CG8701-PA 246 CG8701-PA 80..225 74..230 203 36.7 Plus
CG33340-PA 229 CG33340-PA 76..224 77..237 199 32.7 Plus
hubl-PB 291 CG30364-PB 109..275 56..236 188 32.6 Plus
hubl-PA 291 CG30364-PA 109..275 56..236 188 32.6 Plus
CG12860-PA 316 CG12860-PA 137..297 62..233 159 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20915-PA 272 GI20915-PA 106..270 74..237 225 36.3 Plus
Dmoj\GI20912-PA 250 GI20912-PA 71..237 64..238 170 34.4 Plus
Dmoj\GI20909-PA 248 GI20909-PA 78..207 73..213 144 37.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10869-PA 261 GL10869-PA 47..259 39..237 233 35.3 Plus
Dper\GL10866-PA 259 GL10866-PA 102..245 88..237 159 36.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11864-PA 216 GA11864-PA 50..212 75..237 333 46.3 Plus
Dpse\GA15789-PA 261 GA15789-PA 47..259 39..237 237 35.3 Plus
Dpse\GA15259-PA 259 GA15259-PA 102..245 88..237 160 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20195-PA 239 GM20195-PA 1..239 1..239 1218 97.1 Plus
Dsec\GM20695-PA 252 GM20695-PA 62..250 48..237 195 33 Plus
Dsec\GM20692-PA 305 GM20692-PA 146..291 88..237 167 36.6 Plus
Dsec\GM15754-PA 262 GM15754-PA 63..260 43..237 158 29.7 Plus
Dsec\GM26593-PA 232 GM26593-PA 89..228 87..238 142 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25666-PA 239 GD25666-PA 1..239 1..239 1214 97.1 Plus
Dsim\GD15278-PA 252 GD15278-PA 62..250 48..237 189 33 Plus
Dsim\GD15275-PA 305 GD15275-PA 146..291 88..237 174 37.3 Plus
Dsim\GD23976-PA 262 GD23976-PA 63..260 43..237 158 29.7 Plus
Dsim\GD21095-PA 232 GD21095-PA 89..228 87..238 142 36.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21490-PA 242 GJ21490-PA 39..241 33..237 252 35.1 Plus
Dvir\GJ20645-PA 276 GJ20645-PA 60..274 31..237 221 35.4 Plus
Dvir\GJ20644-PA 206 GJ20644-PA 13..204 52..237 209 36.1 Plus
Dvir\GJ20641-PA 249 GJ20641-PA 71..235 64..237 192 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19521-PA 232 GK19521-PA 21..230 20..237 327 40.1 Plus
Dwil\GK15755-PA 265 GK15755-PA 54..263 43..237 203 37 Plus
Dwil\GK15759-PA 265 GK15759-PA 100..241 85..237 171 34.2 Plus
Dwil\GK15752-PA 216 GK15752-PA 52..201 73..235 164 38.4 Plus
Dwil\GK15825-PA 289 GK15825-PA 132..275 88..237 163 35.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12298-PA 239 GE12298-PA 1..239 1..239 1168 92.1 Plus
Dyak\GE23091-PA 256 GE23091-PA 38..254 27..237 220 33.5 Plus
Dyak\GE23064-PA 307 GE23064-PA 142..293 84..237 183 38.9 Plus
Dyak\GE19047-PA 239 GE19047-PA 40..237 43..237 161 31.7 Plus
Dyak\GE23478-PA 232 GE23478-PA 89..228 87..238 142 35.4 Plus

AT13777.hyp Sequence

Translation from 103 to 822

> AT13777.hyp
MGVLQTVQRTLLMQHSLGSLTIKRTYDTVKKMNLRRRRLEHLKELKRLDE
MCYKAASRNDKKCHPPVLPLPKMECIDDPCAESEMPLDLDHYTPSDKAAR
KYQRTWCECYMIPKAAVKARKCYPNRPRRKFECPRVSDVECRWDPMPCDD
VKKKPEILIEVPRIGKWPCCKIPTPGCRDGRIPPSCDAGRIPTCCKKRRT
KYPSFSECKKELLDPIPPCECEKKVNMCDVYAYFRHKTH*

AT13777.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12861-PA 239 CG12861-PA 1..239 1..239 1351 100 Plus
boly-PA 255 CG30362-PA 64..253 50..237 255 33.5 Plus
CG4691-PA 262 CG4691-PA 52..260 34..237 245 31.7 Plus
CG2127-PB 289 CG2127-PB 116..275 74..237 230 36 Plus
CG2127-PA 305 CG2127-PA 132..291 74..237 230 36 Plus