Clone AT13913 Report

Search the DGRC for AT13913

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:139
Well:13
Vector:pOTB7
Associated Gene/TranscriptCG6914-RA
Protein status:AT13913.pep: gold
Preliminary Size:500
Sequenced Size:853

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6914 2002-01-01 Sim4 clustering to Release 2
CG6914 2002-06-06 Blastp of sequenced clone
CG6914 2003-01-01 Sim4 clustering to Release 3
CG6914 2008-04-29 Release 5.5 accounting
CG6914 2008-08-15 Release 5.9 accounting
CG6914 2008-12-18 5.12 accounting

Clone Sequence Records

AT13913.complete Sequence

853 bp (853 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119449

> AT13913.complete
TTGACTTTGAAGTCAAATAGGCCTCGTGTCGAAATTCCAACTTCTCGGCC
AGGCCACACTCAAGCCGGAGATGCCTCCGAAACCCAAGCATCGCGACGTA
GCCGGCTTTCTCAGCCGGGTGCGCAACTTCCTGCTGGGCCGCACCCACAA
GACGGCCCATCGCTTCGCGGACATGGTCTCTCCGCGCACTCAGCCGCCCC
CAAACATCCCTAGTGGTCCTACCCAGAGTCTGTTCGCCAACTACTACTAC
ACCAGGGATCCTCGGCGCTTGGTGAAGCCCTTCGTCGACGTGGTGCAGGA
GCACAAGAAGATGCTCACCGCCAAGGTGAAGGAGGAGGAAGCAGCCAAAA
AGGCTCAGGCCAAGTCTGGAGATGCGCCGAAAGATGGTAGCCCCATTCCA
CCTGTCGGGCCCAAGACTACTGATACAAATGAATGCGATGAAGGCAATTC
CGGCGCGAAGAAGCTCCCGACTCCAGGAAAGGTGCATTCTTGGGAGGGGC
CACATTAACCTGTTCAATACCCTCCTTATTCAGAAACTCTTTAGTGTTCA
TTGCTTATTCCATTTCGAATGCACTTTGCAGGCAGTCGTAAAAATGTAAA
TCTAATTAGACGTCAAGGGTGAAAATCATTATTGCACCTGCATGAAAATT
TAATTAAGCACACACAATTATCGAAGTTACAAGCTGGAAAGGCGCAAATC
GAGGTCCAACGGGTTTGTTACAGGCCACAACAATAAATTTGCATGCTTAA
TAACGTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

AT13913.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6914-RA 762 CG6914-RA 1..760 1..760 3800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22595273..22596030 1..758 3790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22606369..22607128 1..760 3800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22599469..22600228 1..760 3800 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:55:53 has no hits.

AT13913.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:05 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22595273..22596030 1..758 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:05:05 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..438 71..508 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..438 71..508 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..438 71..508 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:43 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..438 71..508 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..438 71..508 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:49 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:43 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..758 1..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
CG6914-RA 1..758 1..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:05 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22606369..22607126 1..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:05 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22606369..22607126 1..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:05 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22606369..22607126 1..758 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:39 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22599469..22600226 1..758 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:37 Download gff for AT13913.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22599469..22600226 1..758 100   Plus

AT13913.pep Sequence

Translation from 70 to 507

> AT13913.pep
MPPKPKHRDVAGFLSRVRNFLLGRTHKTAHRFADMVSPRTQPPPNIPSGP
TQSLFANYYYTRDPRRLVKPFVDVVQEHKKMLTAKVKEEEAAKKAQAKSG
DAPKDGSPIPPVGPKTTDTNECDEGNSGAKKLPTPGKVHSWEGPH*

AT13913.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10983-PA 125 GF10983-PA 1..124 1..144 312 52.8 Plus
Dana\GF22195-PA 104 GF22195-PA 6..104 8..142 196 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16264-PA 145 GG16264-PA 1..145 1..145 582 82.8 Plus
Dere\GG12912-PA 104 GG12912-PA 6..104 8..142 217 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16701-PA 165 GH16701-PA 3..165 5..142 297 43.3 Plus
Dgri\GH17584-PA 108 GH17584-PA 6..108 8..142 217 39.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B14.5AL-PA 145 CG6914-PA 1..145 1..145 787 100 Plus
ND-B14.5A-PB 103 CG3621-PB 6..103 8..142 215 40 Plus
ND-B14.5A-PA 103 CG3621-PA 6..103 8..142 215 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15183-PA 103 GI15183-PA 6..103 8..142 229 39.3 Plus
Dmoj\GI11390-PA 156 GI11390-PA 3..75 5..77 220 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13321-PA 101 GL13321-PA 5..101 7..142 233 39 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19953-PA 160 GA19953-PA 1..152 1..143 333 52 Plus
Dpse\GA17565-PA 101 GA17565-PA 5..101 7..142 233 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22454-PA 145 GM22454-PA 1..145 1..145 639 93.1 Plus
Dsec\GM19202-PA 104 GM19202-PA 6..104 8..142 200 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15035-PA 145 GD15035-PA 1..145 1..145 642 93.8 Plus
Dsim\GD16591-PA 104 GD16591-PA 6..104 8..142 200 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17063-PA 103 GJ17063-PA 6..103 8..142 230 40 Plus
Dvir\GJ11644-PA 232 GJ11644-PA 58..132 5..79 211 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16765-PA 164 GK16765-PA 1..164 1..142 284 46.1 Plus
Dwil\GK16034-PA 101 GK16034-PA 6..101 8..142 212 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22618-PA 145 GE22618-PA 1..145 1..145 574 83.4 Plus
Dyak\GE16241-PA 104 GE16241-PA 6..104 8..142 203 34.8 Plus

AT13913.hyp Sequence

Translation from 70 to 507

> AT13913.hyp
MPPKPKHRDVAGFLSRVRNFLLGRTHKTAHRFADMVSPRTQPPPNIPSGP
TQSLFANYYYTRDPRRLVKPFVDVVQEHKKMLTAKVKEEEAAKKAQAKSG
DAPKDGSPIPPVGPKTTDTNECDEGNSGAKKLPTPGKVHSWEGPH*

AT13913.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6914-PA 145 CG6914-PA 1..145 1..145 787 100 Plus
CG3621-PB 103 CG3621-PB 6..103 8..142 215 40 Plus
CG3621-PA 103 CG3621-PA 6..103 8..142 215 40 Plus