Clone AT14009 Report

Search the DGRC for AT14009

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:140
Well:9
Vector:pOTB7
Associated Gene/TranscriptVha13-RA
Protein status:AT14009.pep: gold
Preliminary Size:678
Sequenced Size:740

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6213 2002-01-01 Sim4 clustering to Release 2
CG6213 2002-01-11 Blastp of sequenced clone
CG6213 2003-01-01 Sim4 clustering to Release 3
Vha13 2008-04-29 Release 5.5 accounting
Vha13 2008-08-15 Release 5.9 accounting
Vha13 2008-12-18 5.12 accounting

Clone Sequence Records

AT14009.complete Sequence

740 bp (740 high quality bases) assembled on 2002-01-11

GenBank Submission: AY075202

> AT14009.complete
GTGACTTCGTCATATGACATTTTTCATAGTTCGTCGTCGATTGTGATTCT
GTCGCACTTGCTTTTTTCGACTTGCACAGTATACACCACGGCGAGGAATT
AGAGAAGTTTGGAAATTATGGCCAGCCAGACGCAGGGAATCCAGCAGTTG
CTCGCTGCCGAGAAAAAGGCAGCCGAGAAGGTCGCCGAGGCTCGTAAACG
CAAGGCAAGGAGGTTGAAGCAAGCCAAGGACGAGGCTACCGAGGAGATCG
AGAAGTTCCGCCAGGAGCGCGAGCGCGCCTTCAAGGAGTTCGAGGCCAAG
CACATGGGAAGTCGCGAGGGCGTGGCGGCCAAGATCGATGCGGATATCCG
CGTTAAGCTGGCCGACATGGACCGGGCCATCCAGACCCGCAAGGACCCGT
TCATCCTGGAGATCCTGCAGTACGTGTACAACATCTCGCCCGAGGTGCAC
AAAAACTACAACCACAAGTAAAGAGGTGGCCCCCCAAACTGTGCGCTGTA
AATTCAATGTCCACGTTCAACTCTAATCCATAATTTAGACCCGTAATAAT
AGTGGTTAATCTAACTGGAAACACTGCTGTATTATTATTCCATACATTAA
AGTGAAAATTCGTTGTTGTTCCATGTAGAAAAAAGCGAGCATATTAGTTT
GCCTCCCACTCGCGCGGGATTGTATTATCATTGTTTTGTGTTCTGCCCAA
TACACGTTGTTGTTTTATCCGAAAAAAAAAAAAAAAAAAA

AT14009.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-RA 1098 Vha13-RA 138..862 1..725 3595 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15467113..15467535 721..299 2100 99.8 Minus
chr3R 27901430 chr3R 15468034..15468237 204..1 1005 99.5 Minus
chr3R 27901430 chr3R 15467593..15467693 300..200 505 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:48:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19643254..19643680 725..299 2120 99.8 Minus
3R 32079331 3R 19644201..19644404 204..1 990 99 Minus
3R 32079331 3R 19643738..19643838 300..200 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19384085..19384511 725..299 2120 99.7 Minus
3R 31820162 3R 19385032..19385235 204..1 990 99 Minus
3R 31820162 3R 19384569..19384669 300..200 505 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:36:45 has no hits.

AT14009.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:37:25 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15467113..15467533 301..721 99 <- Minus
chr3R 15467593..15467693 200..300 100 <- Minus
chr3R 15468039..15468237 1..199 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:05:13 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 118..471 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:47 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 118..471 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:00 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 118..471 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:18 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 118..471 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:55 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 118..471 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:48 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 9..729 1..721 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:46 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..721 1..721 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:00 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..703 19..721 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:19 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 9..729 1..721 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:55 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..703 19..721 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:25 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19643258..19643678 301..721 99 <- Minus
3R 19643738..19643838 200..300 100 <- Minus
3R 19644206..19644404 1..199 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:25 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19643258..19643678 301..721 99 <- Minus
3R 19643738..19643838 200..300 100 <- Minus
3R 19644206..19644404 1..199 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:25 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19643258..19643678 301..721 99 <- Minus
3R 19643738..19643838 200..300 100 <- Minus
3R 19644206..19644404 1..199 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:00 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15468980..15469400 301..721 99 <- Minus
arm_3R 15469460..15469560 200..300 100 <- Minus
arm_3R 15469928..15470126 1..199 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:07 Download gff for AT14009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19384089..19384509 301..721 99 <- Minus
3R 19384569..19384669 200..300 100 <- Minus
3R 19385037..19385235 1..199 99   Minus

AT14009.hyp Sequence

Translation from 117 to 470

> AT14009.hyp
MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQE
RERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEIL
QYVYNISPEVHKNYNHK*

AT14009.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-PB 117 CG6213-PB 1..117 1..117 581 100 Plus
Vha13-PA 117 CG6213-PA 1..117 1..117 581 100 Plus

AT14009.pep Sequence

Translation from 117 to 470

> AT14009.pep
MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQE
RERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEIL
QYVYNISPEVHKNYNHK*

AT14009.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17364-PA 117 GF17364-PA 1..117 1..117 565 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15897-PA 117 GG15897-PA 1..117 1..117 589 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22384-PA 118 GH22384-PA 1..117 1..117 540 91.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-PB 117 CG6213-PB 1..117 1..117 581 100 Plus
Vha13-PA 117 CG6213-PA 1..117 1..117 581 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24620-PA 117 GI24620-PA 1..117 1..117 543 92.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11956-PA 117 GL11956-PA 1..117 1..117 542 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19444-PA 117 GA19444-PA 1..117 1..117 542 92.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26899-PA 117 GM26899-PA 1..117 1..117 597 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20107-PA 117 GD20107-PA 1..117 1..117 597 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24533-PA 117 GJ24533-PA 1..117 1..117 540 91.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22514-PA 117 GK22514-PA 1..117 1..117 558 94.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Vha13-PA 117 GE25119-PA 1..117 1..117 589 99.1 Plus