Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT14346.complete Sequence
1070 bp (1070 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113253
> AT14346.complete
AGATGGTGGGTCACACTTTCCAAGGCGCACCACACCACGGATGTGGAGAA
CTCGATGATAATCAGGGATCCGACCGTCTCCCCAAGAACCTGAATGATGT
ACGGCACGTGCGTGTAACCTTTCGGACACATCCTTACATCGGCGACCAGA
AGAAGGATGGCAAACGTGAAGATCCAAGCGCCCACTTTCGGAGCAGGTGA
ACAGGTATCTTTAGGTGGCCAAGGGCTTACCGATATTCCGAGCACGAGGC
ATGCGAATATCATTTCAGTCAAAATTCGTTTTCGGGTGAAAACAGTAACT
GGAGCATTTTGGGAAATTCAAAGTCTACACAAAATTCAAAGAATGGGGCG
AAAAAGGGGTCGAAAGGAGTATTGTCCCCCCATTTACAAGCGCCAGAAAG
TGGCGCGCGTCACTAACAATGGATACCTCAACTTTATGACCGAGTACAAG
AAACGCTTTTACGGACTTTCTCCGCAGGACATGGTGCATTATGCGGCTAA
GCAGTGGACCCAGCTGTCCATGGCTGAGAAGGAAGCTTTCAAGAGCAAGA
AACCATCGACGATTACTTTGAAGAGTCCAGCACAGTACGTGGCCTGTGAG
ATGAAAAGCGATGTCGCCGGAGGACAGCAAAGTTCTTGCCAAAGACAGTC
TCCAAGCGCTCGGCTGAGGGAATCGGAGAGGAGATCGTCCAGATCGAAGA
CCTTGTGCAGATCAGCAAAGAATCGTCAGCGAGGGAAGCCGAAACCTCAG
CAAAGCAAGCGCAGGCTCAGTCACATGGGCTCGGCAGTGGCATATATCCA
CTTCCTGCGCAAGTTCCAAAGGAAGAATACTGAGTTGCGCACCATCGATC
TGCTGAAGACGGCAACTAGATTGTGGTGCCGGTTGCCCGAAAGGCATCGC
CATGCGTTTGAGAGGCCACTTTGGATTGTTACTATAGGAAAATCCTAGGC
TAGGAGTAAGCAGTATGATATGATATATTTTTTTATAGCTCTCAAGACTA
TAAGTCACTTTCACTTTTCTAGATTAAATTAAATCTCATGTTAGAGCAAT
CCAAAAAAAAAAAAAAAAAA
AT14346.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:11:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15510-RB | 1055 | CG15510-RB | 4..1055 | 4..1054 | 5160 | 99.5 | Plus |
CG15510.a | 1055 | CG15510.a | 4..1055 | 4..1054 | 5160 | 99.5 | Plus |
CG15510.b | 1031 | CG15510.b | 4..550 | 4..550 | 2690 | 99.4 | Plus |
CG15510.b | 1031 | CG15510.b | 547..1031 | 571..1054 | 2370 | 99.5 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:41:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 25659411..25659788 | 547..924 | 1890 | 100 | Plus |
chr3R | 27901430 | chr3R | 25659055..25659357 | 247..549 | 1470 | 99 | Plus |
chr3R | 27901430 | chr3R | 25658478..25658723 | 4..249 | 1215 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 25659842..25659971 | 923..1052 | 650 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:49:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29836886..29837263 | 547..924 | 1890 | 100 | Plus |
3R | 32079331 | 3R | 29836530..29836832 | 247..549 | 1470 | 99 | Plus |
3R | 32079331 | 3R | 29835953..29836198 | 4..249 | 1230 | 100 | Plus |
3R | 32079331 | 3R | 29837317..29837449 | 923..1054 | 600 | 98.5 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29577717..29578094 | 547..924 | 1890 | 100 | Plus |
3R | 31820162 | 3R | 29577361..29577663 | 247..549 | 1470 | 99 | Plus |
3R | 31820162 | 3R | 29576784..29577029 | 4..249 | 1230 | 100 | Plus |
3R | 31820162 | 3R | 29578148..29578280 | 923..1054 | 610 | 98.4 | Plus |
Blast to na_te.dros performed 2019-03-16 08:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
blood | 7410 | blood BLOOD 7410bp | 1169..1237 | 837..905 | 138 | 66.7 | Plus |
AT14346.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:42:03 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 25658475..25658722 | 1..248 | 99 | -> | Plus |
chr3R | 25659057..25659357 | 249..549 | 99 | -> | Plus |
chr3R | 25659414..25659787 | 550..923 | 100 | -> | Plus |
chr3R | 25659843..25659971 | 924..1052 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:05:47 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RA | 1..792 | 157..948 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:41 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..606 | 343..948 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:12 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..606 | 343..948 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:02 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RA | 1..792 | 157..948 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:46:16 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..606 | 343..948 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:18 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RA | 1..1053 | 1..1052 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:41 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..1053 | 1..1052 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:12 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..1053 | 1..1052 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:03 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RA | 1..1053 | 1..1052 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:46:16 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15510-RB | 1..1053 | 1..1052 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:03 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29835950..29836197 | 1..248 | 99 | -> | Plus |
3R | 29836532..29836832 | 249..549 | 99 | -> | Plus |
3R | 29836889..29837262 | 550..923 | 100 | -> | Plus |
3R | 29837318..29837447 | 924..1052 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:03 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29835950..29836197 | 1..248 | 99 | -> | Plus |
3R | 29836532..29836832 | 249..549 | 99 | -> | Plus |
3R | 29836889..29837262 | 550..923 | 100 | -> | Plus |
3R | 29837318..29837447 | 924..1052 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:03 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29835950..29836197 | 1..248 | 99 | -> | Plus |
3R | 29836532..29836832 | 249..549 | 99 | -> | Plus |
3R | 29836889..29837262 | 550..923 | 100 | -> | Plus |
3R | 29837318..29837447 | 924..1052 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:12 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25661672..25661919 | 1..248 | 99 | -> | Plus |
arm_3R | 25662254..25662554 | 249..549 | 99 | -> | Plus |
arm_3R | 25662611..25662984 | 550..923 | 100 | -> | Plus |
arm_3R | 25663040..25663169 | 924..1052 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:54 Download gff for
AT14346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29576781..29577028 | 1..248 | 99 | -> | Plus |
3R | 29577363..29577663 | 249..549 | 99 | -> | Plus |
3R | 29577720..29578093 | 550..923 | 100 | -> | Plus |
3R | 29578149..29578278 | 924..1052 | 98 | | Plus |
AT14346.pep Sequence
Translation from 156 to 947
> AT14346.pep
MANVKIQAPTFGAGEQVSLGGQGLTDIPSTRHANIISVKIRFRVKTVTGA
FWEIQSLHKIQRMGRKRGRKEYCPPIYKRQKVARVTNNGYLNFMTEYKKR
FYGLSPQDMVHYAAKQWTQLSMAEKEAFKSKKPSTITLKSPAQYVACEMK
SDVAGGQQSSCQRQSPSARLRESERRSSRSKTLCRSAKNRQRGKPKPQQS
KRRLSHMGSAVAYIHFLRKFQRKNTELRTIDLLKTATRLWCRLPERHRHA
FERPLWIVTIGKS*
AT14346.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:33:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18670-PA | 129 | GF18670-PA | 29..82 | 77..130 | 183 | 57.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:33:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11700-PA | 156 | GG11700-PA | 1..155 | 109..263 | 458 | 69.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Prtl99C-PD | 201 | CG15510-PD | 1..201 | 63..263 | 1057 | 100 | Plus |
Prtl99C-PB | 201 | CG15510-PB | 1..201 | 63..263 | 1057 | 100 | Plus |
Prtl99C-PC | 193 | CG15510-PC | 1..193 | 63..263 | 999 | 96 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:33:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14516-PA | 84 | GL14516-PA | 11..65 | 77..131 | 143 | 47.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:33:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12829-PA | 200 | GM12829-PA | 1..200 | 63..263 | 891 | 82.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:33:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21472-PA | 200 | GD21472-PA | 1..200 | 63..263 | 898 | 83.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:33:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14607-PA | 224 | GK14607-PA | 31..212 | 85..262 | 150 | 28.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:33:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23890-PA | 280 | GE23890-PA | 23..280 | 2..256 | 764 | 66.7 | Plus |
AT14346.hyp Sequence
Translation from 156 to 947
> AT14346.hyp
MANVKIQAPTFGAGEQVSLGGQGLTDIPSTRLANIVSVKIRFRVKTVTGA
FWEIQSLHKIQRMGRKRGRKEYCPPIYKRQKVARVTNNGYLNFMTEYKKR
FYGLSPQDMVHYAAKQWTQLSMAEKEAFKSKKPSTITLKSPAQYVACEMK
SDVAGGQQSSCQRQSPSARLRESERRSSRSKTLCRSAKNRQRGKPKPQQS
KRRLSHMGSAVAYIHFLRKFQRKNTELRTIDLLKTATRLWCRLPERHRHA
FERPLWIVTIGKS*
AT14346.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:11:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15510-PD | 201 | CG15510-PD | 1..201 | 63..263 | 1057 | 100 | Plus |
CG15510-PB | 201 | CG15510-PB | 1..201 | 63..263 | 1057 | 100 | Plus |
CG15510-PC | 193 | CG15510-PC | 1..193 | 63..263 | 999 | 96 | Plus |