Clone AT14909 Report

Search the DGRC for AT14909

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:149
Well:9
Vector:pOTB7
Associated Gene/TranscriptCG11722-RA
Protein status:AT14909.pep: gold
Preliminary Size:641
Sequenced Size:769

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11722 2002-01-01 Sim4 clustering to Release 2
CG11722 2002-06-10 Blastp of sequenced clone
CG11722 2003-01-01 Sim4 clustering to Release 3
CG11722 2008-04-29 Release 5.5 accounting
CG11722 2008-08-15 Release 5.9 accounting
CG11722 2008-12-18 5.12 accounting

Clone Sequence Records

AT14909.complete Sequence

769 bp (769 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070793

> AT14909.complete
CTGATTCGAAAACATATAACAGCTGGCCATGCTTTTATAATTCTTTTGGT
TTTTCTCGATTTCACGTGAATTATTAGCAACATAAATAAAACATAATATA
TTTTTGGCATGGGTCAGGTGGTTTCAATGGTTGCCCGCCGGGCCAATCGC
TTCAATGTCGAGAATCGTGCACATCGCGTCCTCGAGCGCGAGAAGCCAAC
GCCGGCGCCCAAATTTGACTCGAATTTGAGAGACATGGAGCGCACCTTGG
AATTGGATCCCAAGTTCGTGGACAAGCTCAATATGAAAGACTCCAGCTTG
GACGGACGATTGAAAGACGTTTATGTAACCTCGCAGGATCGATTTATCAA
GCGAGTGCAGGAGCGCCAGGCAGCTGAGGCGGCGGCGGACAATGTGGAAC
AGCGACCACTGCCCCTGGAACGCAAAACGCCGGATGATTTTGAGTACGGA
TATCTGGAGCCCAACCGCATTAGCCCCGGTCATTGCACACTGCGCCAGGC
GCTTAAGTTCATCAATGACCACCAGTTGGATCCGGAATCCTGGCCAGCCA
AGAAGATAGCCAATGAGTACAAGCTTAAGGAGCCTCTAGTTGAAAACATA
CTGCACTACTTTAAAACTTTTAATATGTACATACCCGACCAGAAGTACAA
AGACACGATGCTAACTCAAGCCACGCAGCCCCTTCTGCGGGTTAAATCGA
GCTCGGAGGGTAATCCGTAAATAAATCATTCTTGTTCTTTGTTTTAAACC
TAAAAAAAAAAAAAAAAAA

AT14909.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11722-RA 791 CG11722-RA 1..752 1..752 3745 99.8 Plus
CG11722.a 747 CG11722.a 1..747 1..751 3655 99.3 Plus
CG3909-RA 1230 CG3909-RA 1172..1230 752..694 295 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5871040..5871292 253..1 1265 100 Minus
chr3R 27901430 chr3R 5870582..5870828 592..346 1220 99.6 Minus
chr3R 27901430 chr3R 5870365..5870524 751..592 800 100 Minus
chr3R 27901430 chr3R 5870895..5870986 345..254 460 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:49:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10045271..10045523 253..1 1265 100 Minus
3R 32079331 3R 10044813..10045059 592..346 1220 99.6 Minus
3R 32079331 3R 10044595..10044755 752..592 805 100 Minus
3R 32079331 3R 10045126..10045217 345..254 460 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9786102..9786354 253..1 1265 100 Minus
3R 31820162 3R 9785644..9785890 592..346 1220 99.5 Minus
3R 31820162 3R 9785426..9785586 752..592 805 100 Minus
3R 31820162 3R 9785957..9786048 345..254 460 100 Minus
Blast to na_te.dros performed 2019-03-16 16:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Galileo 2304 Dbuz\Galileo GALILEO 2304bp 1123..1161 106..69 111 79.5 Minus

AT14909.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:48:33 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5870365..5870523 593..751 100 <- Minus
chr3R 5870582..5870828 346..592 99 <- Minus
chr3R 5870895..5870986 254..345 100 <- Minus
chr3R 5871040..5871292 1..253 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:06:20 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..612 109..720 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:22 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..612 109..720 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:18 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..612 109..720 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:52 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..612 109..720 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:42:06 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..612 109..720 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:10 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..749 1..749 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:22 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..751 1..751 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:18 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 20..770 1..751 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:52 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 1..749 1..749 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:42:06 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
CG11722-RA 20..770 1..751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:33 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10044813..10045059 346..592 99 <- Minus
3R 10045126..10045217 254..345 100 <- Minus
3R 10044596..10044754 593..751 100 <- Minus
3R 10045271..10045523 1..253 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:33 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10044813..10045059 346..592 99 <- Minus
3R 10045126..10045217 254..345 100 <- Minus
3R 10044596..10044754 593..751 100 <- Minus
3R 10045271..10045523 1..253 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:33 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10044813..10045059 346..592 99 <- Minus
3R 10045126..10045217 254..345 100 <- Minus
3R 10044596..10044754 593..751 100 <- Minus
3R 10045271..10045523 1..253 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:18 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5870318..5870476 593..751 100 <- Minus
arm_3R 5870535..5870781 346..592 99 <- Minus
arm_3R 5870848..5870939 254..345 100 <- Minus
arm_3R 5870993..5871245 1..253 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:05 Download gff for AT14909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9785644..9785890 346..592 99 <- Minus
3R 9785957..9786048 254..345 100 <- Minus
3R 9786102..9786354 1..253 100   Minus
3R 9785427..9785585 593..751 100 <- Minus

AT14909.hyp Sequence

Translation from 108 to 719

> AT14909.hyp
MGQVVSMVARRANRFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELD
PKFVDKLNMKDSSLDGRLKDVYVTSQDRFIKRVQERQAAEAAADNVEQRP
LPLERKTPDDFEYGYLEPNRISPGHCTLRQALKFINDHQLDPESWPAKKI
ANEYKLKEPLVENILHYFKTFNMYIPDQKYKDTMLTQATQPLLRVKSSSE
GNP*

AT14909.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11722-PA 203 CG11722-PA 1..203 1..203 1061 100 Plus

AT14909.pep Sequence

Translation from 108 to 719

> AT14909.pep
MGQVVSMVARRANRFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELD
PKFVDKLNMKDSSLDGRLKDVYVTSQDRFIKRVQERQAAEAAADNVEQRP
LPLERKTPDDFEYGYLEPNRISPGHCTLRQALKFINDHQLDPESWPAKKI
ANEYKLKEPLVENILHYFKTFNMYIPDQKYKDTMLTQATQPLLRVKSSSE
GNP*

AT14909.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17139-PA 201 GF17139-PA 1..199 1..199 860 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17308-PA 203 GG17308-PA 1..203 1..203 1059 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17910-PA 208 GH17910-PA 1..199 1..199 799 75.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11722-PA 203 CG11722-PA 1..203 1..203 1061 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24449-PA 192 GI24449-PA 1..192 1..200 760 70.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27283-PA 206 GL27283-PA 1..200 1..198 899 83 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11161-PA 206 GA11161-PA 1..200 1..198 902 83.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26192-PA 203 GM26192-PA 1..203 1..203 1062 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20741-PA 203 GD20741-PA 1..203 1..203 1069 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10726-PA 194 GJ10726-PA 1..192 1..196 786 75.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22664-PA 197 GK22664-PA 1..195 1..198 770 73.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24711-PA 203 GE24711-PA 1..202 1..202 1044 97.5 Plus