Clone AT15479 Report

Search the DGRC for AT15479

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:154
Well:79
Vector:pOTB7
Associated Gene/TranscriptCG31542-RA
Protein status:AT15479.pep: gold
Sequenced Size:850

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1163 2002-01-01 Sim4 clustering to Release 2
CG31542 2002-04-26 Blastp of sequenced clone
CG31542 2003-01-01 Sim4 clustering to Release 3
CG31542 2008-04-29 Release 5.5 accounting
CG31542 2008-08-15 Release 5.9 accounting
CG34277 2008-08-15 Release 5.9 accounting
CG31542 2008-12-18 5.12 accounting
CG34277 2008-12-18 5.12 accounting

Clone Sequence Records

AT15479.complete Sequence

850 bp (850 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113261

> AT15479.complete
GGACAGCCTGTAGGGACAATTAATTACACCTAAGCCCTAACTTTCGGAAA
ATGTCGTCTCCGTGTGGCAAGTGCAACAACTGTCCCTGCGGCACCAGCGG
CGGAGCCCCACCCCCCCAGCAGCCGCCCCACAGGCCACCCCCCTCGTACG
CCCACCAGCCGCAGCAGCAGCCGGACAGCTGTCCCTATCCGGGTCCGCGG
GGCCAGGGAGCAGGCGGGTGCCAGGTCAACTCGACGCAGCCGCCGGGCGA
TCCCGCCGCATGCAGCCTCTACCAGAGCCGGGGAGCCCCCACCGTGGAGT
GCACGTGCACTCAGAACCGTAGCCGGCCACCTCCGCCATCCGTTCAGGCG
GACCACATCACGTGCAGCCGGGGTCCGCGGGAGCAGCCGCCTGCCCTGGA
GACCCGCTGCACCTGTCGCGAGAAGCCCGCCAAGACGGAGTGCCACTGCG
CCCCGCCGGTGGCCCCGCCTCCCAACCAACAGCAGCAGCAGGCGATGGCC
CAGCCCACCTACGCCAACGTGACCTGTGGCCAGAACGTGCCCAGAGGACC
GCAACCCTATCGCCCGCACCACGGCAACCAGAGTCAGAACCCGAACTCCT
GCGGCCACTGTCGATCGCAGAAGAAGCAGAAGAAGTGCGTCATTCAGTGA
TCTGGATGTCGTGCCACGGGAGAACGTTGGGATCCCAGCAGGCGCTACGC
AGCAGGCTACACAGATTATAACGCTCACAACATGACATGACAGTACTCCC
AAATTTCAGGTTAGCCAAATTTCCAGTTTCGACCTGTTTTCCGGGTCAAT
AAAGCCAATGTGACCGCTAATGGGTAAAGTAAAAAAAAAAAAAAAAAAAA

AT15479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG31542-RA 864 CG31542-RA 31..864 1..834 4170 100 Plus
CG31542.a 852 CG31542.a 16..852 1..834 4115 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1195314..1196089 55..830 3880 100 Plus
chr3R 27901430 chr3R 1195201..1195254 1..54 270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5369655..5370434 55..834 3900 100 Plus
3R 32079331 3R 5369542..5369595 1..54 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5110486..5111265 55..834 3900 100 Plus
3R 31820162 3R 5110373..5110426 1..54 270 100 Plus
Blast to na_te.dros performed 2019-03-15 21:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy2 6841 gypsy2 GYPSY2 6841bp 1222..1276 626..574 108 69.1 Minus

AT15479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:25:02 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1195201..1195254 1..54 100 -> Plus
chr3R 1195314..1196089 55..830 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:07:04 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 1..600 51..650 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:23 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RB 1..600 51..650 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:47:01 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 1..600 51..650 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:13 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 1..600 51..650 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:32 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 1..600 51..650 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:06 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 3..832 1..830 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:23 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 3..832 1..830 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:47:01 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 3..832 1..830 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:13 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 3..832 1..830 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:32 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
CG31542-RA 3..832 1..830 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5369542..5369595 1..54 100 -> Plus
3R 5369655..5370430 55..830 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5369542..5369595 1..54 100 -> Plus
3R 5369655..5370430 55..830 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5369542..5369595 1..54 100 -> Plus
3R 5369655..5370430 55..830 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:47:01 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1195264..1195317 1..54 100 -> Plus
arm_3R 1195377..1196152 55..830 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:55 Download gff for AT15479.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5110486..5111261 55..830 100   Plus
3R 5110373..5110426 1..54 100 -> Plus

AT15479.pep Sequence

Translation from 50 to 649

> AT15479.pep
MSSPCGKCNNCPCGTSGGAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPR
GQGAGGCQVNSTQPPGDPAACSLYQSRGAPTVECTCTQNRSRPPPPSVQA
DHITCSRGPREQPPALETRCTCREKPAKTECHCAPPVAPPPNQQQQQAMA
QPTYANVTCGQNVPRGPQPYRPHHGNQSQNPNSCGHCRSQKKQKKCVIQ*

AT15479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17247-PA 230 GF17247-PA 7..230 1..199 250 39.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12749-PA 198 GG12749-PA 1..198 1..199 845 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17789-PA 213 GH17789-PA 87..213 75..199 171 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG31542-PC 199 CG31542-PC 1..199 1..199 1164 100 Plus
CG31542-PA 199 CG31542-PA 1..199 1..199 1164 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10802-PA 199 GM10802-PA 1..199 1..199 955 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19779-PA 165 GD19779-PA 16..165 50..199 605 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11846-PA 179 GK11846-PA 1..151 1..135 172 41.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25462-PA 213 GE25462-PA 13..213 2..199 622 88.1 Plus

AT15479.hyp Sequence

Translation from 50 to 649

> AT15479.hyp
MSSPCGKCNNCPCGTSGGAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPR
GQGAGGCQVNSTQPPGDPAACSLYQSRGAPTVECTCTQNRSRPPPPSVQA
DHITCSRGPREQPPALETRCTCREKPAKTECHCAPPVAPPPNQQQQQAMA
QPTYANVTCGQNVPRGPQPYRPHHGNQSQNPNSCGHCRSQKKQKKCVIQ*

AT15479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31542-PC 199 CG31542-PC 1..199 1..199 1164 100 Plus
CG31542-PA 199 CG31542-PA 1..199 1..199 1164 100 Plus