Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT15479.complete Sequence
850 bp (850 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113261
> AT15479.complete
GGACAGCCTGTAGGGACAATTAATTACACCTAAGCCCTAACTTTCGGAAA
ATGTCGTCTCCGTGTGGCAAGTGCAACAACTGTCCCTGCGGCACCAGCGG
CGGAGCCCCACCCCCCCAGCAGCCGCCCCACAGGCCACCCCCCTCGTACG
CCCACCAGCCGCAGCAGCAGCCGGACAGCTGTCCCTATCCGGGTCCGCGG
GGCCAGGGAGCAGGCGGGTGCCAGGTCAACTCGACGCAGCCGCCGGGCGA
TCCCGCCGCATGCAGCCTCTACCAGAGCCGGGGAGCCCCCACCGTGGAGT
GCACGTGCACTCAGAACCGTAGCCGGCCACCTCCGCCATCCGTTCAGGCG
GACCACATCACGTGCAGCCGGGGTCCGCGGGAGCAGCCGCCTGCCCTGGA
GACCCGCTGCACCTGTCGCGAGAAGCCCGCCAAGACGGAGTGCCACTGCG
CCCCGCCGGTGGCCCCGCCTCCCAACCAACAGCAGCAGCAGGCGATGGCC
CAGCCCACCTACGCCAACGTGACCTGTGGCCAGAACGTGCCCAGAGGACC
GCAACCCTATCGCCCGCACCACGGCAACCAGAGTCAGAACCCGAACTCCT
GCGGCCACTGTCGATCGCAGAAGAAGCAGAAGAAGTGCGTCATTCAGTGA
TCTGGATGTCGTGCCACGGGAGAACGTTGGGATCCCAGCAGGCGCTACGC
AGCAGGCTACACAGATTATAACGCTCACAACATGACATGACAGTACTCCC
AAATTTCAGGTTAGCCAAATTTCCAGTTTCGACCTGTTTTCCGGGTCAAT
AAAGCCAATGTGACCGCTAATGGGTAAAGTAAAAAAAAAAAAAAAAAAAA
AT15479.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:39:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31542-RA | 864 | CG31542-RA | 31..864 | 1..834 | 4170 | 100 | Plus |
CG31542.a | 852 | CG31542.a | 16..852 | 1..834 | 4115 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:24:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 1195314..1196089 | 55..830 | 3880 | 100 | Plus |
chr3R | 27901430 | chr3R | 1195201..1195254 | 1..54 | 270 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:24:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 5369655..5370434 | 55..834 | 3900 | 100 | Plus |
3R | 32079331 | 3R | 5369542..5369595 | 1..54 | 270 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 5110486..5111265 | 55..834 | 3900 | 100 | Plus |
3R | 31820162 | 3R | 5110373..5110426 | 1..54 | 270 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 21:24:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy2 | 6841 | gypsy2 GYPSY2 6841bp | 1222..1276 | 626..574 | 108 | 69.1 | Minus |
AT15479.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:25:02 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 1195201..1195254 | 1..54 | 100 | -> | Plus |
chr3R | 1195314..1196089 | 55..830 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:07:04 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 1..600 | 51..650 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:23 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RB | 1..600 | 51..650 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:47:01 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 1..600 | 51..650 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:13 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 1..600 | 51..650 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:32 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 1..600 | 51..650 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:06 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 3..832 | 1..830 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:23 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 3..832 | 1..830 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:47:01 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 3..832 | 1..830 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:13 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 3..832 | 1..830 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:32 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31542-RA | 3..832 | 1..830 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5369542..5369595 | 1..54 | 100 | -> | Plus |
3R | 5369655..5370430 | 55..830 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5369542..5369595 | 1..54 | 100 | -> | Plus |
3R | 5369655..5370430 | 55..830 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:25:02 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5369542..5369595 | 1..54 | 100 | -> | Plus |
3R | 5369655..5370430 | 55..830 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:47:01 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 1195264..1195317 | 1..54 | 100 | -> | Plus |
arm_3R | 1195377..1196152 | 55..830 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:55 Download gff for
AT15479.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5110486..5111261 | 55..830 | 100 | | Plus |
3R | 5110373..5110426 | 1..54 | 100 | -> | Plus |
AT15479.pep Sequence
Translation from 50 to 649
> AT15479.pep
MSSPCGKCNNCPCGTSGGAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPR
GQGAGGCQVNSTQPPGDPAACSLYQSRGAPTVECTCTQNRSRPPPPSVQA
DHITCSRGPREQPPALETRCTCREKPAKTECHCAPPVAPPPNQQQQQAMA
QPTYANVTCGQNVPRGPQPYRPHHGNQSQNPNSCGHCRSQKKQKKCVIQ*
AT15479.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:19:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17247-PA | 230 | GF17247-PA | 7..230 | 1..199 | 250 | 39.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:19:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12749-PA | 198 | GG12749-PA | 1..198 | 1..199 | 845 | 94 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:19:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH17789-PA | 213 | GH17789-PA | 87..213 | 75..199 | 171 | 40.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31542-PC | 199 | CG31542-PC | 1..199 | 1..199 | 1164 | 100 | Plus |
CG31542-PA | 199 | CG31542-PA | 1..199 | 1..199 | 1164 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:19:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10802-PA | 199 | GM10802-PA | 1..199 | 1..199 | 955 | 97.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:19:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19779-PA | 165 | GD19779-PA | 16..165 | 50..199 | 605 | 94 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:19:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK11846-PA | 179 | GK11846-PA | 1..151 | 1..135 | 172 | 41.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:19:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25462-PA | 213 | GE25462-PA | 13..213 | 2..199 | 622 | 88.1 | Plus |
AT15479.hyp Sequence
Translation from 50 to 649
> AT15479.hyp
MSSPCGKCNNCPCGTSGGAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPR
GQGAGGCQVNSTQPPGDPAACSLYQSRGAPTVECTCTQNRSRPPPPSVQA
DHITCSRGPREQPPALETRCTCREKPAKTECHCAPPVAPPPNQQQQQAMA
QPTYANVTCGQNVPRGPQPYRPHHGNQSQNPNSCGHCRSQKKQKKCVIQ*
AT15479.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:58:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31542-PC | 199 | CG31542-PC | 1..199 | 1..199 | 1164 | 100 | Plus |
CG31542-PA | 199 | CG31542-PA | 1..199 | 1..199 | 1164 | 100 | Plus |