Clone AT15685 Report

Search the DGRC for AT15685

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:156
Well:85
Vector:pOTB7
Associated Gene/TranscriptCG10694-RA
Protein status:AT15685.pep: gold
Preliminary Size:888
Sequenced Size:988

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10694 2002-01-01 Sim4 clustering to Release 2
CG10694 2002-01-18 Blastp of sequenced clone
CG10694 2003-01-01 Sim4 clustering to Release 3
CG10694 2008-04-29 Release 5.5 accounting
CG10694 2008-08-15 Release 5.9 accounting
CG10694 2008-12-18 5.12 accounting

Clone Sequence Records

AT15685.complete Sequence

988 bp (988 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089339

> AT15685.complete
CTTTCACATAACTATCACAAATTCTCGCAGCCAAATTAAGTTTAACAAAA
CAAAAACGATGAAGCTGTCTATACGCATGCTGGACCAACGCACCATCACT
TTGGAGATGAACGAATCGCAGGAGGTGAGGGCTCTGAAGCAGAAATTGGG
CAATTTACCCGAAGTCGCCATGCCCGCGGAGAACCTTCAGCTGATATACA
GTGGCCGCATTATGGAGGATGCCATGCCCCTCAGTGAATATCGTATAGCC
GAGGACAAGATCATTGTGTTGATGGGTAAGAAGAAGGTTGATAAGAGCTC
GCCAGAGGAGAAGGTTGCCCCGACACCACCGTTGGCCGCTGGCCCAAATG
TTTTGCGCACAGAGGATGTGGTGCCTTCACTAGCTCCCAATGATCAGTGG
GTGAGCGATCTCATGTCAATGGGATATGGCGAAGAGGAGGTACGCTCAGC
CCTCCGGGCGAGCTTTAATCATCCGGAAAGGGCTATAGAGTATTTGATTA
ATGGGATTCCTCAGGAGGTTGTTTCAGAGCAGGGATTAGCTGCAATCCCG
AGCGTACAGACAAGTGATCAATTGCAGCAATTAATGGCAGATCTTAACAT
TACACGGATGCGTGAGATGATTAATCAGAATCCAGAACTAATACACAGAC
TAATGAACAGACTGGCTGAAACCGATCCGGCTACCTTCGAAGTCTTTCAG
CGTAACCAGGAGGAGTTAATGAACATGATTTCAGGCGGCGCAAGTCGCAC
CCCGAACGAGATTGAACATTTACAGATTACTTTAACCGCCGAAGAAACCG
CCGCCGTAGGGCGTTTGGAGGCACTGGGTTTCGAACGTGTGATGGCCGTT
CAGGCCTATCTGGCCTGCGACAAGGACGAGCAGCTGGCCGCAGAGGTACT
AATACGCCAGTCAGAAGAGGATCGAGACTAATAAAGCGATTCGGAGCACG
TAAATGCACCCAGAACATAAAAAAAAAAAAAAAAAAAA

AT15685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG10694-RA 968 CG10694-RA 1..968 1..968 4840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19930711..19931678 1..968 4810 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24107391..24108360 1..970 4850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23848222..23849191 1..970 4850 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:47:17 has no hits.

AT15685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:48:02 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19930711..19931678 1..968 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:07:29 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..873 59..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:44 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..873 59..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:56 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..873 59..931 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:16 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..873 59..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:07 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..873 59..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:44 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:44 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:56 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:16 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:07 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10694-RA 1..968 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:48:02 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24107391..24108358 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:48:02 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24107391..24108358 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:48:02 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24107391..24108358 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:56 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19933113..19934080 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:04 Download gff for AT15685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23848222..23849189 1..968 100   Plus

AT15685.hyp Sequence

Translation from 1 to 930

> AT15685.hyp
FHITITNSRSQIKFNKTKTMKLSIRMLDQRTITLEMNESQEVRALKQKLG
NLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSS
PEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSA
LRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNI
TRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEELMNMISGGASRT
PNEIEHLQITLTAEETAAVGRLEALGFERVMAVQAYLACDKDEQLAAEVL
IRQSEEDRD*

AT15685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG10694-PA 290 CG10694-PA 1..290 20..309 1444 100 Plus
Rad23-PC 414 CG1836-PC 1..414 20..307 293 24.9 Plus
Rad23-PA 414 CG1836-PA 1..414 20..307 293 24.9 Plus
Rad23-PB 343 CG1836-PB 89..343 131..307 248 27.8 Plus

AT15685.pep Sequence

Translation from 58 to 930

> AT15685.pep
MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGR
IMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLR
TEDVVPSLAPNDQWVSDLMSMGYGEEEVRSALRASFNHPERAIEYLINGI
PQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRMREMINQNPELIHRLMN
RLAETDPATFEVFQRNQEELMNMISGGASRTPNEIEHLQITLTAEETAAV
GRLEALGFERVMAVQAYLACDKDEQLAAEVLIRQSEEDRD*

AT15685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23005-PA 318 GF23005-PA 1..317 1..288 836 54.1 Plus
Dana\GF19257-PA 405 GF19257-PA 1..405 1..288 318 26.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11252-PA 297 GG11252-PA 1..296 1..290 1089 72.5 Plus
Dere\GG16385-PA 414 GG16385-PA 1..414 1..288 305 26.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18491-PA 282 GH18491-PA 1..280 1..288 594 46.4 Plus
Dgri\GH23932-PA 470 GH23932-PA 196..335 112..225 196 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10694-PA 290 CG10694-PA 1..290 1..290 1444 100 Plus
Rad23-PC 414 CG1836-PC 1..414 1..288 293 24.9 Plus
Rad23-PA 414 CG1836-PA 1..414 1..288 293 24.9 Plus
Rad23-PB 343 CG1836-PB 89..343 112..288 248 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24165-PA 299 GI24165-PA 1..297 1..288 632 46.2 Plus
Dmoj\GI14087-PA 442 GI14087-PA 190..439 112..285 262 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23402-PA 314 GL23402-PA 1..314 1..289 605 45.2 Plus
Dper\GL18167-PA 430 GL18167-PA 173..430 112..288 234 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10501-PA 313 GA10501-PA 1..313 1..289 620 46 Plus
Dpse\GA14903-PA 430 GA14903-PA 173..430 112..288 234 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26556-PA 288 GM26556-PA 1..288 1..290 1285 85.2 Plus
Dsec\GM26792-PA 414 GM26792-PA 1..414 1..288 300 25.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21063-PA 288 GD21063-PA 1..288 1..290 1293 85.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14198-PA 290 GJ14198-PA 1..288 1..288 624 46.2 Plus
Dvir\GJ16257-PA 448 GJ16257-PA 196..448 112..288 272 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11154-PA 284 GK11154-PA 1..281 1..288 645 50.2 Plus
Dwil\GK13711-PA 420 GK13711-PA 1..420 1..288 322 26.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23445-PA 297 GE23445-PA 1..296 1..290 1061 71.3 Plus
Dyak\GE14546-PA 411 GE14546-PA 1..411 1..288 272 25.5 Plus