Clone AT16061 Report

Search the DGRC for AT16061

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:160
Well:61
Vector:pOTB7
Associated Gene/TranscriptCG15450-RA
Protein status:AT16061.pep: gold
Preliminary Size:1224
Sequenced Size:1508

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15450 2002-01-01 Sim4 clustering to Release 2
CG15450 2003-01-01 Sim4 clustering to Release 3
CG15450 2003-08-12 Blastp of sequenced clone
CG15450 2008-04-29 Release 5.5 accounting
CG15450 2008-08-15 Release 5.9 accounting
CG15450 2008-12-18 5.12 accounting

Clone Sequence Records

AT16061.complete Sequence

1508 bp (1508 high quality bases) assembled on 2003-08-12

GenBank Submission: BT011163

> AT16061.complete
GAAACGTCAAAGTCAATAAGCACAAAAATTTCGAAGGCAGTAGGTTTTTT
CGCTTCCTTTACCGAGCCATTACAACATACAATCAGGCGGATCAGACAGA
CGACGACATCGAAATCGAAACGTGGCTACAACAGCTAGCCATGTTAATTC
AACTGGTCTTCCTGGGCATCCTATTGTGGGCGTCCTTCTTTTGGCTGCAG
TGCCGCTACCTGGATGTCCTGGAACTCCTCTTCGCCTGGATAGGCAATCA
GTTGGCGGAAACTCGCAGGAGGCGAGCTCGCGAAGAACGGTGCCGCCTGG
GCAAAAAGTGGGCGGTCGGAAATAAGGGCGATGGCATGGAGAAGCTGCTC
TCGCCGCCGATCAAGAATCGTCTCAATATCCGAGTGGAGCAGTGCTGCGA
CTTCATAACCGCCGGCTTGGGCTTGGTGCTCGAGGACGACGTGACCCAGA
GGTTTGTGGCCCCACCTTCGCCAGCTGGGGAATGGAATCTGCTGACCCGC
AACCTTCGTCAGAGGAATCGATACCTCAGCTGGCGTTTAAGGACGGTCTG
GCTGCTGGGCTGGGTTGTACGCTACGGACTGCTTTTGCCCTTCAGGACCA
TTGGCTGCTGGCTGTGCCTGTTCATGATCAGTGGAGTCTCAATGCTGCTG
GGTCACATTCCCGACTGGTGCTTCAAGAAAAAGTTGGTGGAGCTGGTATT
GCGGCAGTGCTTCCGAATCACGGCCGCCTGCCTGCCGATGATCCGCAGAT
TCCACAACACGGAGTATCGGCCCACCAAGGGCATCTGTGTGTGCAATCAC
ACGAGCCCCTTAGACGTCCTGGTGCTGATGTGCGATGCCAACTACTCGCT
GACGGGCCAGGTTCACACCGGCATCCTGGGCGTCCTGCAGCGCGCCCTGT
CGAGGGTCTCCCACCACATGTGGTTCGACCGCAAGGAACTGGCCGATCGT
GAGGCTCTGGGTCTGGTGCTCCGCCTACACTGCTCCATGAAGGATCGGCC
GCCGGTCCTGCTCTTCCCCGAGGGCACTTGCATCAACAACACCGCCGTAA
TGCAGTTCAAAAAGGGTAGCTTCGCGGTCAGCGACGTCGTTCATCCAGTG
GCCATTCGATACGATCGCCGATTCGGCGAGGCCTATTGGGACAGCACCCG
TTACTCTATGCTCAGATACATGCTGATGGTGGTCAGCTCGTGGTGCATTT
GCTGCGATGTTTGGTACATGCCGGCACTCAGCCGGTGCAACGACGAGTCC
CCAGTAGAGTTTTCGAATCGAGTGAAGGCCGCAATCGCCGCCCAGGCGAA
TATCGATGATCTGCCCTGGGACGGAAACCTAAAACGCTGGAGTCCCGTCA
GGGACTGGCAATAGTTCAAGCATAGCTTAGGTTCTTACCTTGGCTATTTC
ATATCGCCGTTTGCAATACCGTACGCTGTTGGTATATTGATTGTATGACC
CTTTTGATACTAGTAAATCGATCGATATATTTTAGAGAGCAAAAAAAAAA
AAAAAAAA

AT16061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15450-RA 1756 CG15450-RA 73..1566 1..1494 7470 100 Plus
CG3209-RB 2043 CG3209-RB 1410..1553 1002..1145 240 77.7 Plus
CG3209-RC 2089 CG3209-RC 1413..1556 1002..1145 240 77.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20689607..20690960 137..1490 6770 100 Plus
chrX 22417052 chrX 20687458..20687595 1..138 690 100 Plus
chr2R 21145070 chr2R 19958860..19958964 1002..1106 210 80 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20824288..20825645 137..1494 6790 100 Plus
X 23542271 X 20822146..20822283 1..138 690 100 Plus
2R 25286936 2R 24072855..24072959 1002..1106 210 80 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20809380..20810737 137..1494 6790 100 Plus
X 23527363 X 20807238..20807375 1..138 690 100 Plus
2R 25260384 2R 24074054..24074158 1002..1106 210 80 Plus
Blast to na_te.dros performed 2019-03-16 06:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3522..3620 1466..1365 115 59.8 Minus

AT16061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:47 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20687458..20687595 1..138 100 -> Plus
chrX 20689609..20690960 139..1490 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:01 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1224 141..1364 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:44:38 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1224 141..1364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:46 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1224 141..1364 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:12:36 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1224 141..1364 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:38 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1224 141..1364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:09:10 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:44:38 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:46 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:12:36 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:38 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
CG15450-RA 1..1490 1..1490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:47 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
X 20822146..20822283 1..138 100 -> Plus
X 20824290..20825641 139..1490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:47 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
X 20822146..20822283 1..138 100 -> Plus
X 20824290..20825641 139..1490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:47 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
X 20822146..20822283 1..138 100 -> Plus
X 20824290..20825641 139..1490 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:46 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20693173..20693310 1..138 100 -> Plus
arm_X 20695317..20696668 139..1490 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:11 Download gff for AT16061.complete
Subject Subject Range Query Range Percent Splice Strand
X 20809382..20810733 139..1490 100   Plus
X 20807238..20807375 1..138 100 -> Plus

AT16061.hyp Sequence

Translation from 2 to 1363

> AT16061.hyp
NVKVNKHKNFEGSRFFRFLYRAITTYNQADQTDDDIEIETWLQQLAMLIQ
LVFLGILLWASFFWLQCRYLDVLELLFAWIGNQLAETRRRRAREERCRLG
KKWAVGNKGDGMEKLLSPPIKNRLNIRVEQCCDFITAGLGLVLEDDVTQR
FVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLPFRTI
GCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAACLPMIRRF
HNTEYRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALS
RVSHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVM
QFKKGSFAVSDVVHPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSSWCIC
CDVWYMPALSRCNDESPVEFSNRVKAAIAAQANIDDLPWDGNLKRWSPVR
DWQ*

AT16061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15450-PA 407 CG15450-PA 1..407 47..453 2215 100 Plus
CG3209-PB 458 CG3209-PB 113..442 121..453 909 47.7 Plus
CG3209-PC 459 CG3209-PC 113..443 121..453 848 45.8 Plus
CG3209-PD 537 CG3209-PD 284..521 216..453 739 54.2 Plus
CG3209-PE 380 CG3209-PE 185..364 269..453 548 54.1 Plus
CG3209-PD 537 CG3209-PD 113..273 121..283 302 35.4 Plus

AT16061.pep Sequence

Translation from 140 to 1363

> AT16061.pep
MLIQLVFLGILLWASFFWLQCRYLDVLELLFAWIGNQLAETRRRRAREER
CRLGKKWAVGNKGDGMEKLLSPPIKNRLNIRVEQCCDFITAGLGLVLEDD
VTQRFVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLP
FRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAACLPM
IRRFHNTEYRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQ
RALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINN
TAVMQFKKGSFAVSDVVHPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSS
WCICCDVWYMPALSRCNDESPVEFSNRVKAAIAAQANIDDLPWDGNLKRW
SPVRDWQ*

AT16061.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21703-PA 440 GF21703-PA 1..440 1..407 1608 70 Plus
Dana\GF11367-PA 539 GF11367-PA 286..523 170..407 759 53.8 Plus
Dana\GF22630-PA 558 GF22630-PA 102..346 152..383 177 24.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19698-PA 439 GG19698-PA 1..439 1..407 1862 83.6 Plus
Dere\GG22933-PA 537 GG22933-PA 284..521 170..407 755 54.2 Plus
Dere\GG18969-PA 474 GG18969-PA 77..326 147..383 182 24.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17744-PA 405 GH17744-PA 27..405 23..407 1169 59.5 Plus
Dgri\GH21717-PA 537 GH21717-PA 286..523 170..407 755 54.2 Plus
Dgri\GH12406-PA 556 GH12406-PA 95..344 147..383 173 24.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15450-PA 407 CG15450-PA 1..407 1..407 2215 100 Plus
Gpat4-PB 458 CG3209-PB 113..442 75..407 909 47.7 Plus
Gpat4-PC 459 CG3209-PC 113..443 75..407 848 45.8 Plus
Gpat4-PD 537 CG3209-PD 284..521 170..407 739 54.2 Plus
Gpat4-PE 380 CG3209-PE 185..364 223..407 548 54.1 Plus
Gpat4-PD 537 CG3209-PD 113..273 75..237 302 35.4 Plus
LPCAT-PB 533 CG32699-PB 74..307 147..369 182 24.5 Plus
Gpat4-PE 380 CG3209-PE 113..193 75..158 176 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18864-PA 538 GI18864-PA 279..524 163..407 733 52 Plus
Dmoj\GI18864-PA 538 GI18864-PA 115..275 75..237 286 34.1 Plus
Dmoj\GI15857-PA 554 GI15857-PA 95..349 147..388 176 24.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15809-PA 417 GL15809-PA 1..417 1..406 1254 57.2 Plus
Dper\GL11661-PA 531 GL11661-PA 280..517 170..407 750 53.8 Plus
Dper\GL13112-PA 512 GL13112-PA 88..313 147..361 170 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13739-PA 417 GA13739-PA 1..417 1..406 1254 57.4 Plus
Dpse\GA16670-PA 531 GA16670-PA 280..517 170..407 750 53.8 Plus
Dpse\GA23062-PA 512 GA23062-PA 88..313 147..361 170 24.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18300-PA 537 GM18300-PA 284..521 170..407 755 54.2 Plus
Dsec\GM23052-PA 281 GM23052-PA 1..211 1..213 707 73.9 Plus
Dsec\GM23052-PA 281 GM23052-PA 144..281 270..407 650 89.1 Plus
Dsec\GM11357-PA 452 GM11357-PA 74..323 147..383 182 24.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24693-PA 435 GD24693-PA 29..435 1..407 2096 96.6 Plus
Dsim\GD11832-PA 537 GD11832-PA 284..521 170..407 756 54.2 Plus
Dsim\GD16057-PA 361 GD16057-PA 28..232 189..383 164 23.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19255-PA 425 GJ19255-PA 5..425 2..407 1203 59.1 Plus
Dvir\GJ20434-PA 537 GJ20434-PA 279..523 163..407 754 52.2 Plus
Dvir\GJ19019-PA 439 GJ19019-PA 52..301 147..383 157 24 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19819-PA 326 GK19819-PA 1..326 82..407 1199 70.9 Plus
Dwil\GK21924-PA 536 GK21924-PA 285..522 170..407 754 53.4 Plus
Dwil\GK10139-PA 552 GK10139-PA 69..294 147..361 171 24.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17896-PA 407 GE17896-PA 1..407 1..407 1957 89.7 Plus
Dyak\GE14370-PA 537 GE14370-PA 284..521 170..407 756 54.2 Plus
Dyak\GE15443-PA 455 GE15443-PA 77..326 147..383 182 24.1 Plus