Clone AT16075 Report

Search the DGRC for AT16075

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:160
Well:75
Vector:pOTB7
Associated Gene/Transcriptswif-RA
Protein status:AT16075.pep: gold
Sequenced Size:1031

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30366 2003-01-01 Sim4 clustering to Release 3
CG30366 2004-03-05 Blastp of sequenced clone
CG30366 2008-04-29 Release 5.5 accounting
CG30366 2008-08-15 Release 5.9 accounting
CG30363 2008-08-15 Release 5.9 accounting
CG30366 2008-12-18 5.12 accounting
CG30363 2008-12-18 5.12 accounting

Clone Sequence Records

AT16075.complete Sequence

1031 bp (1031 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012336

> AT16075.complete
CGAAAAATCATTAGGCCAAATCAAAATTCTCAAAATTTTAAGCATGCAGT
CAGCACTGTGGATCTTTTGCAGACAAGGTTTCAGGAGCTTTGCCACTAAA
GCGCAAGGTTTCAGAAGCTTCGCCAGCAAAGTGACCTACCACGCGGATCC
GCCATGCCAACCTGTCGACCCTTTGTGCCATCATGTTCCAAGCGGCAGAT
GCGTGCAGGCCAGGGAAACGATCAATCTCAAACTGCCACATGAGAGGTTA
TTGAAGCAAGAACGCGATCAGAAGAAGGAGAGGAAATGCTGTGTCCTGCG
ATCGGCGGCCAAAAATCCCTGCGTAGAGATAAGACGACCCAAAGCCGCAA
AGCTGGAGGAGAAGCCATTCCGTTCGATGTGGGAGCCACCTTGCAAGGCG
AACGAGCAGCCGTTCTGCAAGGAAATGCTGCCCCGCTTCGATGCGATGTA
CTACCATCCCTCAAACAAGTGCCGCTGCTACCAACGCACCTGGGTGGAGT
GTTCACCCGTTAAGAAACGGCTGAAGAAGGTTTGCTGCCTGGACGCCATC
GAACCTCCTGAGATTCTGTACCGGATCAGGCCGCCCTGCCCAGGAACTTG
CCAAATCAACTATAAGGCTCGAAGGCTACTCTGTGCGGATGGAGAATGGG
AGCGGGACCCAACGAGGAAGTGTCCGAAATTCTTTCACCCCTGTTGCAAG
CTGGCTCGCTGCAATCCTCGTTGCTCCAGAGGCAGAAAGCCTACCCTATG
CACCAAGTTGCGAGCTCCATATCCTTGTTACTCAGAAAAAATAAGAGGAA
CAAGACCGCTCCGAAAAAGAGAGTGCCTTTGCTTGGAGACCACCCCGAAA
TGTATAGCTCTTGCGGAAAGAATGAGACGCGATGGATTAAATCTGTGATA
ATCCTACCGAAACACGTAAAAGTGCAAGTTGAGGGTCTGGCTTTTAAAAC
GAAGTAATAGATACAAAGTGATGTTTCTATTAATTTGCTTTAGCAGTCAG
GTATCCGATCCTAACAAAAAAAAAAAAAAAA

AT16075.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
swif-RA 1021 swif-RA 1..1021 1..1021 5105 100 Plus
cola-RA 2075 cola-RA 958..1978 1..1021 5105 100 Plus
swif-RB 2075 swif-RB 958..1978 1..1021 5105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4250898..4251914 1015..1 4975 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8363368..8364388 1021..1 5105 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8364567..8365587 1021..1 5105 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:49:13 has no hits.

AT16075.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:16 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4250898..4251914 1..1015 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:03 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG30366-RB 1..855 44..898 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:48 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
swif-RB 1..855 44..898 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:20 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
swif-RA 1..855 44..898 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:33 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG30366-RB 1..855 44..898 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:43:32 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
swif-RA 1..855 44..898 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:46:55 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG30366-RB 958..1972 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:48 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
swif-RB 958..1972 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:20 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
swif-RA 1..1015 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:33 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG30366-RB 958..1972 1..1015 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:43:32 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
cola-RA 958..1972 1..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:16 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8363374..8364388 1..1015 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:16 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8363374..8364388 1..1015 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:16 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8363374..8364388 1..1015 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:20 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4250879..4251893 1..1015 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:59 Download gff for AT16075.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8364573..8365587 1..1015 100   Minus

AT16075.hyp Sequence

Translation from 1 to 897

> AT16075.hyp
EKSLGQIKILKILSMQSALWIFCRQGFRSFATKAQGFRSFASKVTYHADP
PCQPVDPLCHHVPSGRCVQARETINLKLPHERLLKQERDQKKERKCCVLR
SAAKNPCVEIRRPKAAKLEEKPFRSMWEPPCKANEQPFCKEMLPRFDAMY
YHPSNKCRCYQRTWVECSPVKKRLKKVCCLDAIEPPEILYRIRPPCPGTC
QINYKARRLLCADGEWERDPTRKCPKFFHPCCKLARCNPRCSRGRKPTLC
TKLRAPYPCYSEKIRGTRPLRKRECLCLETTPKCIALAERMRRDGLNL*

AT16075.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
swif-PB 284 CG30366-PB 1..284 15..298 1606 100 Plus
swif-PA 284 CG30366-PA 1..284 15..298 1606 100 Plus
hubl-PB 291 CG30364-PB 54..272 51..293 293 31 Plus
hubl-PA 291 CG30364-PA 54..272 51..293 293 31 Plus
CG11635-PA 286 CG11635-PA 41..235 102..293 219 33.6 Plus

AT16075.pep Sequence

Translation from 43 to 897

> AT16075.pep
MQSALWIFCRQGFRSFATKAQGFRSFASKVTYHADPPCQPVDPLCHHVPS
GRCVQARETINLKLPHERLLKQERDQKKERKCCVLRSAAKNPCVEIRRPK
AAKLEEKPFRSMWEPPCKANEQPFCKEMLPRFDAMYYHPSNKCRCYQRTW
VECSPVKKRLKKVCCLDAIEPPEILYRIRPPCPGTCQINYKARRLLCADG
EWERDPTRKCPKFFHPCCKLARCNPRCSRGRKPTLCTKLRAPYPCYSEKI
RGTRPLRKRECLCLETTPKCIALAERMRRDGLNL*

AT16075.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19809-PA 280 GF19809-PA 3..277 1..284 667 50.9 Plus
Dana\GF12596-PA 309 GF12596-PA 72..296 72..284 265 36.1 Plus
Dana\GF20746-PA 237 GF20746-PA 57..211 99..263 174 33.5 Plus
Dana\GF12351-PA 301 GF12351-PA 70..224 99..263 154 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10652-PA 281 GG10652-PA 1..281 1..281 1215 83.3 Plus
Dere\GG10654-PA 291 GG10654-PA 77..283 82..284 243 36.4 Plus
Dere\GG23352-PA 244 GG23352-PA 86..232 125..281 165 36.6 Plus
Dere\GG10647-PA 303 GG10647-PA 124..289 109..279 146 35.8 Plus
Dere\GG11285-PA 232 GG11285-PA 33..227 75..279 145 33.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20820-PA 223 GH20820-PA 4..218 69..284 371 42.8 Plus
Dgri\GH21087-PA 300 GH21087-PA 73..284 71..277 230 35.7 Plus
Dgri\GH20816-PA 242 GH20816-PA 89..227 132..279 152 36.8 Plus
Dgri\GH19654-PA 242 GH19654-PA 89..227 132..279 152 36.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
swif-PB 284 CG30366-PB 1..284 1..284 1606 100 Plus
swif-PA 284 CG30366-PA 1..284 1..284 1606 100 Plus
hubl-PB 291 CG30364-PB 54..272 37..279 293 31 Plus
hubl-PA 291 CG30364-PA 54..272 37..279 293 31 Plus
CG11635-PA 286 CG11635-PA 41..235 88..279 219 33.6 Plus
CG8701-PA 246 CG8701-PA 59..234 97..281 213 33.3 Plus
CG2127-PB 289 CG2127-PB 62..275 75..279 207 33.3 Plus
CG2127-PA 305 CG2127-PA 78..291 75..279 207 33.3 Plus
CG33340-PA 229 CG33340-PA 43..224 90..279 204 32.8 Plus
cola-PA 259 CG30363-PA 34..219 81..263 183 30.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20917-PA 296 GI20917-PA 39..291 34..284 473 46 Plus
Dmoj\GI18687-PA 297 GI18687-PA 137..287 132..283 221 41.8 Plus
Dmoj\GI20909-PA 248 GI20909-PA 85..224 125..270 167 36.5 Plus
Dmoj\GI10075-PA 236 GI10075-PA 75..230 122..280 165 34.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11217-PA 243 GL11217-PA 41..232 89..281 167 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21267-PA 243 GA21267-PA 41..232 89..281 167 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20697-PA 285 GM20697-PA 1..284 1..284 1384 93.3 Plus
Dsec\GM20699-PA 291 GM20699-PA 77..283 82..284 215 33.2 Plus
Dsec\GM21026-PA 288 GM21026-PA 54..235 99..279 158 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15280-PA 285 GD15280-PA 1..284 1..284 1375 92.6 Plus
Dsim\GD15282-PA 291 GD15282-PA 77..272 82..279 215 34 Plus
Dsim\GD15283-PA 291 GD15283-PA 77..272 82..279 213 33.8 Plus
Dsim\GD15373-PA 288 GD15373-PA 54..235 99..279 158 34.5 Plus
Dsim\GD15275-PA 305 GD15275-PA 124..291 109..279 148 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20648-PA 301 GJ20648-PA 16..270 9..262 523 46 Plus
Dvir\GJ21704-PA 303 GJ21704-PA 73..293 71..283 232 34.5 Plus
Dvir\GJ23810-PA 238 GJ23810-PA 55..232 112..280 166 32.8 Plus
Dvir\GJ20639-PA 249 GJ20639-PA 88..234 125..279 147 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19093-PA 213 GK19093-PA 8..211 81..284 475 50.2 Plus
Dwil\GK15761-PA 301 GK15761-PA 82..282 82..278 249 35 Plus
Dwil\GK15752-PA 216 GK15752-PA 31..200 96..276 191 36.6 Plus
Dwil\GK15759-PA 265 GK15759-PA 99..209 129..248 179 40.7 Plus
Dwil\GK19110-PA 237 GK19110-PA 36..230 75..279 171 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23113-PA 284 GE23113-PA 1..284 1..284 1197 81 Plus
Dyak\GE23134-PA 291 GE23134-PA 77..272 82..279 224 35.2 Plus
Dyak\GE19192-PA 245 GE19192-PA 86..234 125..281 166 36.1 Plus
Dyak\GE23064-PA 307 GE23064-PA 126..293 109..279 157 36.4 Plus
Dyak\GE19191-PA 290 GE19191-PA 54..235 99..279 151 34 Plus