Clone AT16129 Report

Search the DGRC for AT16129

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:161
Well:29
Vector:pOTB7
Associated Gene/TranscriptCG17300-RA
Protein status:AT16129.pep: gold
Sequenced Size:723

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11262 2003-01-01 Sim4 clustering to Release 3
CG17300 2004-07-27 Blastp of sequenced clone
CG17300 2008-04-29 Release 5.5 accounting
CG17300 2008-08-15 Release 5.9 accounting
CG17300 2008-12-18 5.12 accounting

Clone Sequence Records

AT16129.complete Sequence

723 bp (723 high quality bases) assembled on 2004-07-27

GenBank Submission: BT015306

> AT16129.complete
TTTTTTTTTTCTGTCACTTTTCTAAACTTTCACTTGCAAAATTACTATCA
TTCAATTCATCCTTAATCCATATACTTACCATTTTACGGCAGTTAATTAA
ACAAAAATTCAATACAACTTTCTTTAGAATGTTCTCGAGATTAGCCTTAC
GTCCTTTGACTGTGGCCACATCTCGTTCGGCTACCACCCATTCCGCCCAA
GGACTAAGTAGGCTCCCTGGGCATGGAAGTCCCGGAAAGGTTCGCCCGGG
TTTCCCGTCCGACAATTGGGTTAAAGGACCCATGGGCGTCGGCCTGTTGG
CATATATCTGTTCCGGAGACTGTTGCGCCATTAAGCACGAGCACAGCGGC
CTATCCTTGGGCATCATGGAAGATGGCTACTACAGCAGTGGAATCACCAT
CGGTATCCTGACCACATTTGCTGTGATTAGGCTTCTTCCAGCGATTGTAA
AGTGGGCTGATAGCGAGATTATTAAAATTGAGTCCGAGTACGAAAAGAGT
CGTGAAACTAAGATCAAGGTCCTATCAATCTCGCCCTCGAACGGAAATAA
GGATCCTAGCAAGGATAATGCCGATCAAAACGTGTAGTCGATTTGTTGTA
TTACTTATTTCAATTTGTGAACACATGTCCGTGTAAAAAATAAAAATTTG
GGTGTAAGAGGAGCTCTGGTTGAAGATGTAATTAAACAACTATGAACAAA
CAACAAAAAAAAAAAAAAAAAAA

AT16129.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17300-RA 720 CG17300-RA 23..720 7..704 3490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13077032..13077363 473..142 1660 100 Minus
chr3L 24539361 chr3L 13076675..13076905 704..474 1155 100 Minus
chr3L 24539361 chr3L 13077439..13077576 144..7 690 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13086744..13087075 473..142 1660 100 Minus
3L 28110227 3L 13086386..13086617 705..474 1160 100 Minus
3L 28110227 3L 13087151..13087288 144..7 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13079844..13080175 473..142 1660 100 Minus
3L 28103327 3L 13079486..13079717 705..474 1160 100 Minus
3L 28103327 3L 13080251..13080388 144..7 690 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:16:44 has no hits.

AT16129.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:17:42 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13076675..13076905 474..704 100 <- Minus
chr3L 13077032..13077360 145..473 100 <- Minus
chr3L 13077439..13077572 11..144 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:08 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 1..459 129..587 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:30 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 1..459 129..587 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:10:16 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 1..459 129..587 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:24 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 1..459 129..587 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:54 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 1..459 129..587 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:39:24 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 6..699 11..704 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:30 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 6..699 11..704 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:10:16 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 6..699 11..704 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:24 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 6..699 11..704 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:54 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
CG17300-RA 6..699 11..704 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:42 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13086387..13086617 474..704 100 <- Minus
3L 13086744..13087072 145..473 100 <- Minus
3L 13087151..13087284 11..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:42 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13086387..13086617 474..704 100 <- Minus
3L 13086744..13087072 145..473 100 <- Minus
3L 13087151..13087284 11..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:42 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13086387..13086617 474..704 100 <- Minus
3L 13086744..13087072 145..473 100 <- Minus
3L 13087151..13087284 11..144 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:10:16 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13079844..13080172 145..473 100 <- Minus
arm_3L 13080251..13080384 11..144 100   Minus
arm_3L 13079487..13079717 474..704 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:27 Download gff for AT16129.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13079487..13079717 474..704 100 <- Minus
3L 13079844..13080172 145..473 100 <- Minus
3L 13080251..13080384 11..144 100   Minus

AT16129.hyp Sequence

Translation from 11 to 586

> AT16129.hyp
CHFSKLSLAKLLSFNSSLIHILTILRQLIKQKFNTTFFRMFSRLALRPLT
VATSRSATTHSAQGLSRLPGHGSPGKVRPGFPSDNWVKGPMGVGLLAYIC
SGDCCAIKHEHSGLSLGIMEDGYYSSGITIGILTTFAVIRLLPAIVKWAD
SEIIKIESEYEKSRETKIKVLSISPSNGNKDPSKDNADQNV*

AT16129.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17300-PA 152 CG17300-PA 1..152 40..191 789 100 Plus
ATPsyn-b-PA 243 CG8189-PA 1..137 40..172 245 43.3 Plus

AT16129.pep Sequence

Translation from 128 to 586

> AT16129.pep
MFSRLALRPLTVATSRSATTHSAQGLSRLPGHGSPGKVRPGFPSDNWVKG
PMGVGLLAYICSGDCCAIKHEHSGLSLGIMEDGYYSSGITIGILTTFAVI
RLLPAIVKWADSEIIKIESEYEKSRETKIKVLSISPSNGNKDPSKDNADQ
NV*

AT16129.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24674-PA 245 GF24674-PA 1..139 1..133 217 42.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13783-PA 151 GG13783-PA 1..142 1..142 604 81.7 Plus
Dere\GG15409-PA 243 GG15409-PA 1..137 1..133 222 43.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15429-PA 246 GH15429-PA 1..149 1..142 211 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17300-PA 152 CG17300-PA 1..152 1..152 789 100 Plus
ATPsynB-PA 243 CG8189-PA 1..137 1..133 245 43.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13031-PA 245 GI13031-PA 1..148 1..142 222 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16292-PA 245 GL16292-PA 1..139 1..133 210 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20881-PA 245 GA20881-PA 1..139 1..133 210 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24609-PA 152 GM24609-PA 1..152 1..152 753 93.4 Plus
Dsec\GM25183-PA 243 GM25183-PA 1..137 1..133 222 43.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12675-PA 141 GD12675-PA 1..141 12..152 709 95.7 Plus
Dsim\GD14214-PA 243 GD14214-PA 1..137 1..133 222 43.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12126-PA 246 GJ12126-PA 1..139 1..133 204 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10957-PA 243 GK10957-PA 38..137 30..133 195 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20077-PA 73 GE20077-PA 1..71 80..150 288 80.3 Plus
Dyak\GE20875-PA 243 GE20875-PA 1..137 1..133 222 43.3 Plus