Clone AT16150 Report

Search the DGRC for AT16150

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:161
Well:50
Vector:pOTB7
Associated Gene/TranscriptCG5024-RA
Protein status:AT16150.pep: gold
Preliminary Size:643
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5024 2002-01-01 Sim4 clustering to Release 2
CG5024 2003-01-01 Sim4 clustering to Release 3
CG5024 2003-01-22 Blastp of sequenced clone
CG5024 2008-04-29 Release 5.5 accounting
CG5024 2008-08-15 Release 5.9 accounting
CG5024 2008-12-18 5.12 accounting

Clone Sequence Records

AT16150.complete Sequence

664 bp (664 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075218

> AT16150.complete
GTCAATGAAAAGACAATATTTAAACACAAAAATTTTCGAAAAACTAAATT
TTAAAATTCATCTTTTCGGGAAACCCAAATTTTCAGCCCAAGGTATACTT
ACAATTTGCCATGGATGACTTTGATTTCAGTAGTCCACCTCCGGAGGTAC
GAACAGTTCATACCCACACGCTGAATGATGAACAGCTCAAGGATTGTGAG
GCGGCCTTCGCCCTCTTCGACGACGATAATGCCAAGGTCATTCCGATCAA
GTTATTGAGAGATTGCCTGCGAGCCGTGGCCCACAACCCGCCGGAAAACG
AGATACAGGATTATATCACCGAAATTGATACGGATGGATCCGGCGAGCTT
TATCTCAGTGATTTCCTATACATCATGTCGAAACGGTACGAGAATTTGAC
TGTCGAAGATGAAGTTATCCTCGCGTTCAAAGTCTTCGACAAAGATGGAT
CTGGCTTTATACACGAGAATGAGTTCCGTCAGATAATGACTGAATATGGC
GATGAAATGGAAGAGGACGAGATCGAGGAAATGATACGTGATGCCGACGC
CAACACGGAACTGAAAATCGACTACGTTCGCTTTGTGACCATGATGATGG
AGACGTAACACTCTCTTTGAAAAATAAAAAAACATAACCGATTGTAAAAA
AAAAAAAAAAAAAA

AT16150.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5024-RA 680 CG5024-RA 1..644 1..646 3060 98.7 Plus
CG5024-RB 680 CG5024-RB 1..644 1..646 3060 98.7 Plus
And-RB 1224 And-RB 284..426 319..461 205 76.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21634072..21634715 1..645 3160 99.7 Plus
chr3R 27901430 chr3R 21635164..21635306 319..461 205 76.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25811096..25811739 1..646 3040 98.8 Plus
3R 32079331 3R 25812194..25812336 319..461 205 76.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25551927..25552570 1..646 3060 98.7 Plus
3R 31820162 3R 25553025..25553167 319..461 205 76.2 Plus
Blast to na_te.dros performed on 2019-03-16 16:49:15 has no hits.

AT16150.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:17 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21634072..21634715 1..645 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:12 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..498 111..608 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:44 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RB 1..498 111..608 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:22 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..498 111..608 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:35 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..498 111..608 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:43:37 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..498 111..608 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:13 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..643 1..645 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:44 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..643 1..645 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:22 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..643 1..645 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:35 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..643 1..645 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:43:37 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
CG5024-RA 1..643 1..645 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:17 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811096..25811738 1..645 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:17 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811096..25811738 1..645 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:17 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811096..25811738 1..645 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:22 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21636818..21637460 1..645 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:30 Download gff for AT16150.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25551927..25552569 1..645 98   Plus

AT16150.pep Sequence

Translation from 110 to 607

> AT16150.pep
MDDFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLR
DCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVED
EVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE
LKIDYVRFVTMMMET*

AT16150.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16770-PA 165 GF16770-PA 1..165 1..165 678 77.6 Plus
Dana\GF16771-PA 165 GF16771-PA 1..165 1..165 539 62.4 Plus
Dana\GF12835-PA 149 GF12835-PA 5..146 21..162 315 41.5 Plus
Dana\GF16772-PA 148 GF16772-PA 4..145 21..162 258 38.7 Plus
Dana\GF13647-PA 148 GF13647-PA 4..145 21..162 234 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11423-PA 165 GG11423-PA 1..165 1..165 757 93.9 Plus
Dere\GG11424-PA 164 GG11424-PA 2..164 3..165 503 57.7 Plus
Dere\GG20265-PA 149 GG20265-PA 5..146 21..162 315 41.5 Plus
Dere\GG11425-PA 148 GG11425-PA 4..145 21..162 253 37.3 Plus
Dere\GG23318-PA 147 GG23318-PA 3..145 20..162 219 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23399-PA 166 GH23399-PA 6..165 5..164 437 55 Plus
Dgri\GH23405-PA 151 GH23405-PA 7..150 21..164 263 38.2 Plus
Dgri\GH10976-PA 190 GH10976-PA 43..187 21..165 227 32.4 Plus
Dgri\GH21304-PA 151 GH21304-PA 5..147 18..160 225 34.3 Plus
Dgri\GH22800-PA 122 GH22800-PA 3..105 16..118 221 40.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5024-PB 165 CG5024-PB 1..165 1..165 864 100 Plus
CG5024-PA 165 CG5024-PA 1..165 1..165 864 100 Plus
CG17770-PA 164 CG17770-PA 2..164 3..165 516 58.9 Plus
Cam-PD 149 CG8472-PD 5..146 21..162 317 41.5 Plus
Cam-PC 149 CG8472-PC 5..146 21..162 317 41.5 Plus
Cam-PE 149 CG8472-PE 5..146 21..162 317 41.5 Plus
Cam-PB 149 CG8472-PB 5..146 21..162 317 41.5 Plus
Cam-PA 149 CG8472-PA 5..146 21..162 317 41.5 Plus
Acam-PB 148 CG17769-PB 4..147 21..164 264 36.8 Plus
Acam-PA 148 CG17769-PA 4..147 21..164 264 36.8 Plus
CG31960-PA 148 CG31960-PA 16..145 33..162 244 35.4 Plus
azot-PA 148 CG11165-PA 16..145 33..162 239 33.8 Plus
CG30378-PA 148 CG30378-PA 4..146 20..162 227 32.9 Plus
CG17493-PD 182 CG17493-PD 35..179 21..165 221 30.3 Plus
CG17493-PC 182 CG17493-PC 35..179 21..165 221 30.3 Plus
CG17493-PB 182 CG17493-PB 35..179 21..165 221 30.3 Plus
CG11638-PA 387 CG11638-PA 210..357 25..164 200 30.9 Plus
CG31802-PA 186 CG31802-PA 36..183 18..165 197 29.1 Plus
TpnC73F-PC 155 CG7930-PC 8..152 21..162 188 29 Plus
TpnC73F-PA 155 CG7930-PA 8..152 21..162 188 29 Plus
TpnC47D-PB 155 CG9073-PB 8..152 21..162 186 28.3 Plus
TpnC47D-PA 155 CG9073-PA 8..152 21..162 186 28.3 Plus
Mlc-c-PA 147 CG3201-PA 6..145 23..163 178 29.4 Plus
CG13898-PA 151 CG13898-PA 6..147 19..160 173 28.2 Plus
Mlc-c-PB 153 CG3201-PB 15..151 26..163 171 29.3 Plus
TpnC41C-PB 154 CG2981-PB 5..149 21..162 168 26.9 Plus
TpnC41C-PA 154 CG2981-PA 5..149 21..162 168 26.9 Plus
Eip63F-1-PC 181 CG15855-PC 13..181 14..163 160 26 Plus
Eip63F-1-PA 193 CG15855-PA 25..193 14..163 160 26 Plus
sqh-PE 174 CG3595-PE 32..164 25..162 157 25.4 Plus
sqh-PD 174 CG3595-PD 32..164 25..162 157 25.4 Plus
sqh-PC 174 CG3595-PC 32..164 25..162 157 25.4 Plus
sqh-PB 174 CG3595-PB 32..164 25..162 157 25.4 Plus
sqh-PA 174 CG3595-PA 32..164 25..162 157 25.4 Plus
Eip63F-1-PD 166 CG15855-PD 9..166 25..163 156 27.2 Plus
CG11041-PB 155 CG11041-PB 5..130 21..141 148 27.8 Plus
Eip63F-1-PB 161 CG15855-PB 6..161 27..163 144 26.9 Plus
TpnC25D-PC 149 CG6514-PC 3..146 22..162 142 22.2 Plus
TpnC25D-PA 149 CG6514-PA 3..146 22..162 142 22.2 Plus
TpnC4-PB 153 CG12408-PB 9..151 24..162 139 25.9 Plus
TpnC4-PA 153 CG12408-PA 9..151 24..162 139 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes120-PA 166 GI10338-PA 4..165 3..164 537 61.1 Plus
Dmoj\GI20594-PA 149 GI20594-PA 5..146 21..162 315 41.5 Plus
Dmoj\GI10339-PA 149 GI10339-PA 5..148 21..164 271 37.5 Plus
Dmoj\GI19794-PA 151 GI19794-PA 7..147 20..160 246 36.2 Plus
Dmoj\GI17489-PA 205 GI17489-PA 58..202 21..165 235 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21534-PA 165 GL21534-PA 1..164 1..164 519 61 Plus
Dper\GL10814-PA 149 GL10814-PA 5..146 21..162 315 41.5 Plus
Dper\GL21535-PA 148 GL21535-PA 4..145 21..162 272 39.4 Plus
Dper\GL21536-PA 148 GL21536-PA 4..145 21..162 260 38 Plus
Dper\GL11703-PA 149 GL11703-PA 9..147 24..162 257 36 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26321-PA 165 GA26321-PA 1..164 1..164 518 61 Plus
Dpse\GA24499-PA 149 GA24499-PA 5..146 21..162 315 41.5 Plus
Dpse\GA14657-PA 148 GA14657-PA 4..145 21..162 273 39.4 Plus
Dpse\GA24239-PA 149 GA24239-PA 9..147 24..162 263 36 Plus
Dpse\GA26322-PA 148 GA26322-PA 4..145 21..162 260 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10263-PA 165 GM10263-PA 1..165 1..165 860 98.8 Plus
Dsec\GM10264-PA 164 GM10264-PA 2..164 3..165 524 59.5 Plus
Dsec\GM21351-PA 149 GM21351-PA 5..146 21..162 315 41.5 Plus
Dsec\GM10265-PA 148 GM10265-PA 4..145 21..162 256 37.3 Plus
Dsec\GM20994-PA 148 GM20994-PA 15..145 32..162 233 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21233-PA 165 GD21233-PA 1..165 1..165 860 98.8 Plus
Dsim\GD21234-PA 164 GD21234-PA 3..164 4..165 527 59.3 Plus
Dsim\GD10849-PA 149 GD10849-PA 5..146 21..162 315 41.5 Plus
Dsim\GD21235-PA 148 GD21235-PA 4..145 21..162 256 37.3 Plus
Dsim\GD10523-PA 148 GD10523-PA 15..145 32..162 226 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10192-PA 166 GJ10192-PA 4..165 3..164 524 62.3 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 7..150 21..164 267 38.2 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..110 53..162 263 42.7 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 43..187 21..165 225 32.4 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 1..148 13..160 216 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18987-PA 167 GK18987-PA 3..166 2..164 507 60.4 Plus
Dwil\GK22183-PA 149 GK22183-PA 5..146 21..162 315 41.5 Plus
Dwil\GK18988-PA 148 GK18988-PA 4..145 21..162 295 40.8 Plus
Dwil\GK15343-PA 197 GK15343-PA 50..194 21..165 232 33.1 Plus
Dwil\GK21975-PA 147 GK21975-PA 4..142 21..159 218 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23617-PA 165 GE23617-PA 1..165 1..165 751 92.7 Plus
Dyak\GE23619-PA 164 GE23619-PA 2..164 3..165 514 57.7 Plus
Dyak\Cam-PA 149 GE12425-PA 5..146 21..162 315 41.5 Plus
Dyak\GE23620-PA 148 GE23620-PA 4..145 21..162 260 38.7 Plus
Dyak\GE19162-PA 147 GE19162-PA 2..145 19..162 214 31.9 Plus

AT16150.hyp Sequence

Translation from 110 to 607

> AT16150.hyp
MDDFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLR
DCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVED
EVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE
LKIDYVRFVTMMMET*

AT16150.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5024-PB 165 CG5024-PB 1..165 1..165 864 100 Plus
CG5024-PA 165 CG5024-PA 1..165 1..165 864 100 Plus
CG17770-PA 164 CG17770-PA 2..164 3..165 516 58.9 Plus
Cam-PD 149 CG8472-PD 5..146 21..162 317 41.5 Plus
Cam-PC 149 CG8472-PC 5..146 21..162 317 41.5 Plus