AT16234.complete Sequence
786 bp (786 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113268
> AT16234.complete
CCCCGTTTTACTTTTTCTACGTTCCTCCCATTTAACAGGCAAACTAATAC
AATAGACAAGTCTTAAATTTACATACTCCCTCCTTTCGGCCAATCCTTTA
AGCCAAATAAACGCTACACCACAGTACAACTGCATCCAGCTGAAGGCTAA
CCAATACCTAAGGTATCCGGACCACGAAATTACAGGCAAATCCGACTAGT
TTTATCCCCTTTCCAAATGCTGCCAGCCAATGGAAACCAATCGGCCCTAT
CCGCCTATGTCCGACTGGCGGTCCAGCAAGCCACGTCCCGAATGACTGGA
AGATTCGCCTACTCGACGCGCCGAAACCAGTGCGTTGGGGATCTGAAGAA
GATCGACGAAGTCCTGTGCCACCAGCGGGATGAACCCAATCCAGAATACC
ATCATGCTCCGCGATGCTTTGTTAAGAACTTTCATAAGTACCAGGAGCAG
GCGCAGGATCACGGAGAGGTGCAGACGACCCGCTTCCGCAATCCGCGATA
CCGCTGGGCAGACTTCCGGCGACGAATGGTTTATGGCACCTACGATATCT
AGACGGTTTCTCTTGATGCTCTCTGCAATCAATTTCCATCCGGACATGTC
TTGTACGAGTATAGTCCCCCCCAGTCTATCCATAACGAAGTATCCCAAAC
CCACATGCAAACTGTACAATAGTAAGAATTTTGAGGCCAGATAAACGGAT
CCAACTCGGTCGTCCGCTCAAATTGCAATATAATTCAGCACAGAATAAAT
CCGTTACCTCTTAAGTTTAAAAAAAAAAAAAAAAAA
AT16234.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:39:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2291-RA | 818 | CG2291-RA | 48..818 | 1..769 | 3740 | 99.2 | Plus |
CG2291.a | 793 | CG2291.a | 208..754 | 225..769 | 2635 | 99 | Plus |
CG2291.a | 793 | CG2291.a | 48..209 | 1..162 | 810 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:11:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 4148142..4148911 | 768..1 | 3725 | 99.2 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8260646..8261416 | 769..1 | 3730 | 99.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 8261845..8262615 | 769..1 | 3740 | 99.2 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:11:39 has no hits.
AT16234.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:12:31 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 4148142..4148911 | 1..768 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:24 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 1..336 | 217..552 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:31 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 1..336 | 217..552 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:16 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 1..336 | 217..552 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:21 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 1..336 | 217..552 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:03:22 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 1..336 | 217..552 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:16 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 48..817 | 1..768 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:30 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 48..817 | 1..768 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:16 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 48..817 | 1..768 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:22 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 48..817 | 1..768 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:03:22 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2291-RA | 48..817 | 1..768 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:31 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8260647..8261416 | 1..768 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:31 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8260647..8261416 | 1..768 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:12:31 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8260647..8261416 | 1..768 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:16 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4148152..4148921 | 1..768 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:34:03 Download gff for
AT16234.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8261846..8262615 | 1..768 | 99 | | Minus |
AT16234.pep Sequence
Translation from 216 to 551
> AT16234.pep
MLPANGNQSALSAYVRLAVQQATSRMTGRFAYSTRRNQCVGDLKKIDEVL
CHQRDEPNPEYHHAPRCFVKNFHKYQEQAQDHGEVQTTRFRNPRYRWADF
RRRMVYGTYDI*
AT16234.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:21:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10661-PA | 111 | GG10661-PA | 1..111 | 1..111 | 494 | 83.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2291-PA | 111 | CG2291-PA | 1..111 | 1..111 | 607 | 100 | Plus |
CG2291-PB | 86 | CG2291-PB | 1..86 | 26..111 | 488 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:21:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI20923-PA | 95 | GI20923-PA | 2..95 | 23..111 | 199 | 46.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:21:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20706-PA | 111 | GM20706-PA | 1..111 | 1..111 | 569 | 94.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:21:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21434-PA | 111 | GD21434-PA | 1..111 | 1..111 | 582 | 95.5 | Plus |
Dsim\GD10176-PA | 111 | GD10176-PA | 1..111 | 1..111 | 575 | 93.7 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:21:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ20652-PA | 96 | GJ20652-PA | 11..96 | 28..111 | 198 | 45.5 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:21:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19095-PA | 114 | GK19095-PA | 50..114 | 53..111 | 184 | 58.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:21:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23188-PA | 111 | GE23188-PA | 1..111 | 1..111 | 531 | 90.1 | Plus |
AT16234.hyp Sequence
Translation from 216 to 551
> AT16234.hyp
MLPANGNQSALSAYVRLAVQQATSRMTGRFAYSTRRNQCVGDLKKIDEVL
CHQRDEPNPEYHHAPRCFVKNFHKYQEQAQDHGEVQTTRFRNPRYRWADF
RRRMVYGTYDI*
AT16234.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2291-PA | 111 | CG2291-PA | 1..111 | 1..111 | 607 | 100 | Plus |
CG2291-PB | 86 | CG2291-PB | 1..86 | 26..111 | 488 | 100 | Plus |