Clone AT16284 Report

Search the DGRC for AT16284

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:162
Well:84
Vector:pOTB7
Associated Gene/TranscriptTim17b1-RA
Protein status:AT16284.pep: gold
Preliminary Size:618
Sequenced Size:806

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1158 2002-01-01 Sim4 clustering to Release 2
CG1158 2002-04-26 Blastp of sequenced clone
CG1158 2003-01-01 Sim4 clustering to Release 3
Tim17b1 2008-04-29 Release 5.5 accounting
Tim17b1 2008-08-15 Release 5.9 accounting
Tim17b1 2008-12-18 5.12 accounting

Clone Sequence Records

AT16284.complete Sequence

806 bp (806 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113269

> AT16284.complete
CATCAATTTTATCGACTGAACTCTCCTGAGTCCGATAATCAACTGACATG
GCGGAGTACGGTCGGGAGCCTTGTCCCTTTCGCATTGTCGAGGATTGTGG
TGGAGCCTTCGCAATGGGCGCCTTGGGCGGAGGAGCCTTCCAGGCGATCA
AGGGCTTTCGAAACGCCCCCTCCGGCCTGGGATACCGATTGAGCGGAGGA
TTGGCGGCGGTACGGGCTCGATCCGGCCTGGTGGGTGGTAACTTTGCGGT
GTGGGGCGCTACCTTCAGCGCCATCGACTGCTCACTGGTTTACTTCCGGA
AGAAGGAGGACCCGTGGAACGCCATAATTAGTGGAGCAACCACCGGGGGC
ATTCTTGCTGCTAGAACTGGACTAACCTCCATGCTCAGTAGTGCCTTGGT
GGGCGGGGCTCTATTGGCCCTAATAGAGGGCGTGGGCATTGTGGTGTCCC
ATTATTCGGCGGATTCCTACCGCCAGGTGTCGCCCGTGGAGCGGCAGCAA
CGGTATAAGCAGGAGCTTTTACGGCAGCAAAAGGGCGTTTCTCCACTCGC
AGCGACTTATGGAGAGATTGACTCTTCGGCATTGTAGAATTCTTCGCTGC
GTCATCGCCTAGTCGTCGCTATCCATCCGCGAACGCGTGGATCGACGATT
GCATACCAATTTATAAAAGATTGCTTTGATTGTTCGAATCTGATACTGGC
GGCATTCCCATTTCAATTTAAATTCAATTGTCGTACAGTGCAAGTTTTAG
AATCATAAATATATTTTGCTTCGGCATATTTATATAGAAAAAAAAAAAAA
AAAAAA

AT16284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b1-RA 968 Tim17b1-RA 111..898 1..788 3940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1125809..1126178 1..370 1850 100 Plus
chr3R 27901430 chr3R 1126630..1126852 565..787 1115 100 Plus
chr3R 27901430 chr3R 1126368..1126565 369..566 990 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5300145..5300514 1..370 1850 100 Plus
3R 32079331 3R 5300966..5301189 565..788 1120 100 Plus
3R 32079331 3R 5300704..5300901 369..566 990 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5040976..5041345 1..370 1850 100 Plus
3R 31820162 3R 5041797..5042020 565..788 1120 100 Plus
3R 31820162 3R 5041535..5041732 369..566 990 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:55:05 has no hits.

AT16284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:55:57 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1125809..1126177 1..369 100 -> Plus
chr3R 1126369..1126565 370..566 100 -> Plus
chr3R 1126632..1126852 567..787 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:27 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..540 48..587 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:13:07 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..540 48..587 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:13 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..540 48..587 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:04:11 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..540 48..587 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:56:33 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..540 48..587 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:35:39 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:13:07 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:13 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..785 1..785 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:04:12 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:56:33 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17b1-RA 1..785 1..785 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:57 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5300705..5300901 370..566 100 -> Plus
3R 5300145..5300513 1..369 100 -> Plus
3R 5300968..5301188 567..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:57 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5300705..5300901 370..566 100 -> Plus
3R 5300145..5300513 1..369 100 -> Plus
3R 5300968..5301188 567..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:57 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5300705..5300901 370..566 100 -> Plus
3R 5300145..5300513 1..369 100 -> Plus
3R 5300968..5301188 567..787 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:13 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1125867..1126235 1..369 100 -> Plus
arm_3R 1126427..1126623 370..566 100 -> Plus
arm_3R 1126690..1126910 567..787 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:35:52 Download gff for AT16284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5040976..5041344 1..369 100 -> Plus
3R 5041536..5041732 370..566 100 -> Plus
3R 5041799..5042019 567..787 100   Plus

AT16284.hyp Sequence

Translation from 47 to 586

> AT16284.hyp
MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSG
GLAAVRARSGLVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTG
GILAARTGLTSMLSSALVGGALLALIEGVGIVVSHYSADSYRQVSPVERQ
QRYKQELLRQQKGVSPLAATYGEIDSSAL*

AT16284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b1-PA 179 CG1158-PA 1..179 1..179 911 100 Plus
Tim17b-PB 173 CG40451-PB 1..146 1..146 545 67.8 Plus
Tim17b-PA 173 CG40451-PA 1..146 1..146 545 67.8 Plus
CG1724-PA 185 CG1724-PA 1..146 1..146 522 63 Plus
Tim17b2-PC 176 CG15257-PC 1..146 1..146 516 60.3 Plus

AT16284.pep Sequence

Translation from 47 to 586

> AT16284.pep
MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSG
GLAAVRARSGLVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTG
GILAARTGLTSMLSSALVGGALLALIEGVGIVVSHYSADSYRQVSPVERQ
QRYKQELLRQQKGVSPLAATYGEIDSSAL*

AT16284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18933-PA 184 GF18933-PA 1..184 1..179 662 68.5 Plus
Dana\GF20543-PA 171 GF20543-PA 1..146 1..146 544 66.4 Plus
Dana\GF15384-PA 181 GF15384-PA 1..151 1..151 538 63.6 Plus
Dana\GF16065-PA 224 GF16065-PA 2..160 3..157 457 55.3 Plus
Dana\GF15488-PA 206 GF15488-PA 2..168 3..172 380 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12726-PA 175 GG12726-PA 1..175 1..179 812 89.9 Plus
Dere\GG13145-PA 173 GG13145-PA 1..146 1..146 545 67.1 Plus
Dere\GG17552-PA 186 GG17552-PA 1..146 1..146 525 63.7 Plus
Dere\GG25162-PA 177 GG25162-PA 1..146 1..146 516 60.3 Plus
Dere\GG17140-PA 222 GG17140-PA 2..167 3..165 448 51.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17768-PA 185 GH17768-PA 1..185 1..179 629 68.1 Plus
Dgri\GH19590-PA 172 GH19590-PA 1..146 1..146 549 67.1 Plus
Dgri\GH13757-PA 172 GH13757-PA 1..146 1..146 540 66.4 Plus
Dgri\GH22709-PA 232 GH22709-PA 1..180 1..176 463 50.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17b1-PA 179 CG1158-PA 1..179 1..179 911 100 Plus
Tim17b-PB 173 CG40451-PB 1..146 1..146 545 67.8 Plus
Tim17b-PA 173 CG40451-PA 1..146 1..146 545 67.8 Plus
CG1724-PA 185 CG1724-PA 1..146 1..146 522 63 Plus
Tim17b2-PC 176 CG15257-PC 1..146 1..146 516 60.3 Plus
Tim17b2-PA 176 CG15257-PA 1..146 1..146 516 60.3 Plus
Tim17a1-PB 222 CG10090-PB 2..137 3..138 445 59.6 Plus
Tim17a1-PA 222 CG10090-PA 2..137 3..138 445 59.6 Plus
Tim17a2-PA 224 CG14666-PA 2..139 3..139 439 58.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22546-PA 217 GI22546-PA 1..155 1..155 641 78.1 Plus
Dmoj\GI23631-PA 172 GI23631-PA 1..146 1..146 548 67.1 Plus
Dmoj\GI17897-PA 177 GI17897-PA 1..161 1..161 538 61.5 Plus
Dmoj\Tes127-PA 223 GI10214-PA 1..157 1..156 446 52.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12286-PA 173 GL12286-PA 1..146 1..146 552 67.8 Plus
Dper\GL26428-PA 171 GL26428-PA 1..146 1..146 497 62.3 Plus
Dper\GL14996-PA 191 GL14996-PA 2..154 3..155 446 54.9 Plus
Dper\GL22194-PA 202 GL22194-PA 2..162 3..160 430 47.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26255-PA 173 GA26255-PA 1..146 1..146 552 67.8 Plus
Dpse\GA26353-PA 172 GA26353-PA 3..172 6..179 508 54 Plus
Dpse\GA28858-PA 171 GA28858-PA 1..146 1..146 499 63 Plus
Dpse\GA22481-PA 191 GA22481-PA 2..151 3..152 458 57.3 Plus
Dpse\GA13158-PA 202 GA13158-PA 2..162 3..160 432 48.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10800-PA 179 GM10800-PA 1..179 1..179 901 97.8 Plus
Dsec\GM23215-PA 173 GM23215-PA 1..149 1..148 549 67.8 Plus
Dsec\GM22636-PA 185 GM22636-PA 1..152 1..152 521 60.5 Plus
Dsec\GM16089-PA 478 GM16089-PA 1..146 1..146 505 58.9 Plus
Dsec\GM26023-PA 222 GM26023-PA 2..137 3..138 450 59.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19775-PA 179 GD19775-PA 1..179 1..179 898 97.2 Plus
Dsim\GD24434-PA 185 GD24434-PA 1..146 1..146 519 62.3 Plus
Dsim\GD24009-PA 420 GD24009-PA 1..146 1..146 504 58.9 Plus
Dsim\GD20580-PA 222 GD20580-PA 2..137 3..138 451 59.6 Plus
Dsim\GD11957-PA 119 GD11957-PA 1..115 1..115 450 69.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10150-PA 189 GJ10150-PA 1..158 1..159 639 78 Plus
Dvir\GJ11192-PA 172 GJ11192-PA 1..146 1..146 548 67.1 Plus
Dvir\GJ17402-PA 177 GJ17402-PA 1..146 1..146 538 67.1 Plus
Dvir\GJ11015-PA 224 GJ11015-PA 1..134 1..134 445 59 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12968-PA 180 GK12968-PA 1..166 1..166 600 69.9 Plus
Dwil\GK12238-PA 173 GK12238-PA 1..146 1..146 561 69.9 Plus
Dwil\GK18250-PA 179 GK18250-PA 1..147 1..147 537 65.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25459-PA 179 GE25459-PA 1..179 1..179 803 88.3 Plus
Dyak\GE15312-PA 185 GE15312-PA 1..146 1..146 536 65.1 Plus
Dyak\GE21001-PA 177 GE21001-PA 1..146 1..146 519 60.3 Plus
Dyak\GE24530-PA 222 GE24530-PA 2..158 3..160 443 53.8 Plus