Clone AT16346 Report

Search the DGRC for AT16346

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:163
Well:46
Vector:pOTB7
Associated Gene/TranscriptCG6888-RA
Protein status:AT16346.pep: gold
Preliminary Size:591
Sequenced Size:715

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6888 2002-01-01 Sim4 clustering to Release 2
CG6888 2003-01-01 Sim4 clustering to Release 3
CG6888 2003-01-22 Blastp of sequenced clone
CG6888 2008-04-29 Release 5.5 accounting
CG6888 2008-08-15 Release 5.9 accounting
CG6888 2008-12-18 5.12 accounting

Clone Sequence Records

AT16346.complete Sequence

715 bp (715 high quality bases) assembled on 2003-01-22

GenBank Submission: AY089342

> AT16346.complete
CTCAAAACAAAAAGCTAATACAAAACCGTTAAGATGCGTATGCTCAATAT
TAACCAAGTGGCTCCTAATTTTACTACCAATGCGGTGGTATCCGGTGGTT
ATCGTAATTTTGCTCTTACGGATTTGCGTGGCAGATACGTCCTGTTGGTC
TTTTATCCGGCTGACTTTTCGTACGTCTGCCCCACGGAGTTGCAGGCATT
CAGCGATAGAGCTCCGGAATTCAGGAATGTGGGCTGCGAAGTCTTGGCCT
GTTCCACTGATAGTCACTTTGTGCACTGCGCCTGGATGAATACTCCCAGG
AAGAACGGAGGTCTGGGTGAGTTGGACATACCATTGTTGGCCGACAAGAA
CATGAAGATAGCCAGGGACTATGGAGTTCTCGATGAGGACACCGGATTGG
CTCTACGCGCCCTTTTCATCATCGATCGCGAGGGACGCATTCGCCAGATC
ACGGTGAATGACATGGGAGTGGGTCGCAGTGTGGATGAGGCACTGCGTCT
GGTTCAGGCCTTCCAGTTCAGCGATGAGTTCGGAGAGGTCTGCCCGGTCA
ACTGGCGTCCCGGAGCAAAGACCATGAAGGCCGATGCAACCGGAAAGGAG
GAGTACTTCAAGCACGCGATTTAAGTGTTTAATACAATAGGCTTTATACT
AAAGTGTATGGTAGCCATTAAATAAAACATACTTATGAACATTCAAAAAA
AAAAAAAAAAAAAAA

AT16346.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6888-RA 749 CG6888-RA 50..746 1..697 3410 99.2 Plus
Jafrac1-RA 1013 Jafrac1-RA 540..683 442..585 255 78.4 Plus
Jafrac1-RB 1307 Jafrac1-RB 651..794 442..585 255 78.4 Plus
Jafrac1-RA 1013 Jafrac1-RA 378..487 280..389 190 78.1 Plus
Jafrac1-RB 1307 Jafrac1-RB 489..598 280..389 190 78.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15197986..15198679 1..694 3410 99.4 Plus
chrX 22417052 chrX 13222193..13222498 280..585 390 75.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15207893..15208589 1..697 3410 99.3 Plus
X 23542271 X 13331362..13331667 280..585 390 75.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15200993..15201689 1..697 3410 99.2 Plus
X 23527363 X 13339622..13339765 442..585 255 78.4 Plus
X 23527363 X 13339460..13339569 280..389 190 78.1 Plus
Blast to na_te.dros performed on 2019-03-16 12:19:37 has no hits.

AT16346.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:20:46 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15197986..15198679 1..694 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:33 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 1..591 34..624 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:26 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 1..591 34..624 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:29:04 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 1..591 34..624 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:25 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 1..591 34..624 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:16 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 1..591 34..624 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:46 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 50..743 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:26 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 50..743 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:29:04 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 50..743 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:25 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 50..743 1..694 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:16 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6888-RA 50..743 1..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:46 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15207893..15208586 1..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:46 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15207893..15208586 1..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:46 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15207893..15208586 1..694 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:29:04 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15200993..15201686 1..694 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:32 Download gff for AT16346.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15200993..15201686 1..694 99   Plus

AT16346.pep Sequence

Translation from 33 to 623

> AT16346.pep
MRMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCP
TELQAFSDRAPEFRNVGCEVLACSTDSHFVHCAWMNTPRKNGGLGELDIP
LLADKNMKIARDYGVLDEDTGLALRALFIIDREGRIRQITVNDMGVGRSV
DEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFKHAI*

AT16346.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23670-PA 196 GF23670-PA 1..195 1..195 939 86.2 Plus
Dana\GF19402-PA 194 GF19402-PA 1..190 3..192 690 61.6 Plus
Dana\GF24261-PA 244 GF24261-PA 53..239 6..192 591 56.7 Plus
Dana\GF15932-PA 234 GF15932-PA 37..234 1..195 523 48.5 Plus
Dana\GF12124-PA 220 GF12124-PA 1..196 4..193 260 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15885-PA 196 GG15885-PA 1..195 1..195 1032 97.9 Plus
Dere\GG17772-PA 194 GG17772-PA 1..191 3..193 691 61.3 Plus
Dere\GG14898-PA 242 GG14898-PA 52..238 6..192 589 56.1 Plus
Dere\GG16768-PA 234 GG16768-PA 40..234 4..195 524 49.2 Plus
Dere\GG24478-PA 222 GG24478-PA 4..198 2..193 251 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14416-PA 195 GH14416-PA 4..194 6..195 749 69.1 Plus
Dgri\GH15986-PA 243 GH15986-PA 53..239 6..192 583 56.1 Plus
Dgri\GH17487-PA 231 GH17487-PA 37..231 4..195 529 49.7 Plus
Dgri\GH17696-PA 288 GH17696-PA 175..266 2..93 288 51.1 Plus
Dgri\GH20103-PA 220 GH20103-PA 1..184 4..181 256 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6888-PA 196 CG6888-PA 1..196 1..196 1035 100 Plus
Jafrac1-PE 194 CG1633-PE 1..191 3..193 665 61.8 Plus
Jafrac1-PD 194 CG1633-PD 1..191 3..193 665 61.8 Plus
Jafrac1-PC 194 CG1633-PC 1..191 3..193 665 61.8 Plus
Jafrac1-PA 194 CG1633-PA 1..191 3..193 665 61.8 Plus
Jafrac1-PB 194 CG1633-PB 1..191 3..193 665 61.8 Plus
Jafrac2-PC 242 CG1274-PC 52..238 6..192 557 56.1 Plus
Jafrac2-PB 242 CG1274-PB 52..238 6..192 557 56.1 Plus
Jafrac2-PA 242 CG1274-PA 52..238 6..192 557 56.1 Plus
Prx3-PA 234 CG5826-PA 40..233 4..194 517 50.5 Plus
Prx6005-PA 222 CG3083-PA 4..186 2..181 237 31.2 Plus
Prx2540-2-PA 220 CG11765-PA 1..196 4..193 229 32 Plus
Prx2540-1-PA 220 CG12405-PA 1..196 4..193 228 32 Plus
CG12896-PA 220 CG12896-PA 1..196 4..193 226 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13545-PA 268 GI13545-PA 72..268 1..196 753 68 Plus
Dmoj\GI16105-PA 194 GI16105-PA 1..190 3..192 688 61.1 Plus
Dmoj\GI16636-PA 243 GI16636-PA 53..239 6..192 587 55.6 Plus
Dmoj\GI22813-PA 233 GI22813-PA 39..233 4..195 539 50.8 Plus
Dmoj\GI20198-PA 220 GI20198-PA 29..196 35..193 236 33.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20930-PA 194 GL20930-PA 1..193 3..195 836 78.8 Plus
Dper\GL26916-PA 194 GL26916-PA 1..190 3..192 682 61.1 Plus
Dper\GL16320-PA 204 GL16320-PA 17..200 10..192 555 56 Plus
Dper\GL13701-PA 233 GL13701-PA 39..233 4..195 530 49.7 Plus
Dper\GL11593-PA 220 GL11593-PA 1..196 4..193 249 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28632-PA 194 GA28632-PA 1..193 3..195 838 79.3 Plus
Dpse\GA14060-PA 200 GA14060-PA 6..196 2..192 686 60.7 Plus
Dpse\GA11781-PA 243 GA11781-PA 53..239 6..192 598 57.8 Plus
Dpse\GA19159-PA 233 GA19159-PA 39..233 4..195 530 49.7 Plus
Dpse\GA11614-PA 220 GA11614-PA 1..196 4..193 249 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25516-PA 196 GM25516-PA 1..196 1..196 1050 99.5 Plus
Dsec\GM11621-PA 194 GM11621-PA 1..191 3..193 690 61.8 Plus
Dsec\GM14524-PA 242 GM14524-PA 52..238 6..192 588 56.1 Plus
Dsec\GM16948-PA 234 GM16948-PA 40..234 4..195 528 49.7 Plus
Dsec\GM21216-PA 220 GM21216-PA 1..196 4..193 249 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14531-PA 196 GD14531-PA 1..196 1..196 1050 99.5 Plus
Dsim\GD17115-PA 194 GD17115-PA 1..191 3..193 690 61.8 Plus
Dsim\GD13721-PA 242 GD13721-PA 52..238 6..192 588 56.1 Plus
Dsim\GD20225-PA 234 GD20225-PA 40..234 4..195 528 49.7 Plus
Dsim\GD25985-PA 220 GD25985-PA 1..184 4..181 243 34 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11904-PA 195 GJ11904-PA 1..194 3..195 767 71.1 Plus
Dvir\GJ15754-PA 194 GJ15754-PA 1..190 3..192 686 61.6 Plus
Dvir\GJ12891-PA 244 GJ12891-PA 54..240 6..192 594 57.2 Plus
Dvir\GJ22817-PA 233 GJ22817-PA 39..233 4..195 543 51.3 Plus
Dvir\GJ17911-PA 224 GJ17911-PA 4..186 2..181 242 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19651-PA 196 GK19651-PA 1..195 1..195 836 74.9 Plus
Dwil\GK20591-PA 196 GK20591-PA 1..195 1..195 834 74.9 Plus
Dwil\GK25196-PA 213 GK25196-PA 20..209 3..192 711 63.2 Plus
Dwil\GK16580-PA 248 GK16580-PA 58..244 6..192 596 57.2 Plus
Dwil\GK19421-PA 159 GK19421-PA 1..144 1..146 573 69.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22230-PA 196 GE22230-PA 1..195 1..195 1010 94.9 Plus
Dyak\Jafrac1-PA 194 GE17062-PA 1..191 3..193 690 61.8 Plus
Dyak\GE20352-PA 242 GE20352-PA 52..238 6..192 586 56.1 Plus
Dyak\GE25263-PA 234 GE25263-PA 37..234 1..195 528 49 Plus
Dyak\GE14982-PA 222 GE14982-PA 4..186 2..181 253 30.6 Plus

AT16346.hyp Sequence

Translation from 33 to 623

> AT16346.hyp
MRMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCP
TELQAFSDRAPEFRNVGCEVLACSTDSHFVHCAWMNTPRKNGGLGELDIP
LLADKNMKIARDYGVLDEDTGLALRALFIIDREGRIRQITVNDMGVGRSV
DEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFKHAI*

AT16346.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6888-PA 196 CG6888-PA 1..196 1..196 1035 100 Plus
Jafrac1-PE 194 CG1633-PE 1..191 3..193 665 61.8 Plus
Jafrac1-PD 194 CG1633-PD 1..191 3..193 665 61.8 Plus
Jafrac1-PC 194 CG1633-PC 1..191 3..193 665 61.8 Plus
Jafrac1-PA 194 CG1633-PA 1..191 3..193 665 61.8 Plus