Clone AT16536 Report

Search the DGRC for AT16536

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:165
Well:36
Vector:pOTB7
Associated Gene/TranscriptBuffy-RA
Protein status:AT16536.pep: gold
Preliminary Size:744
Sequenced Size:1074

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8238 2002-01-01 Sim4 clustering to Release 2
CG8238 2002-01-09 Blastp of sequenced clone
CG8238 2003-01-01 Sim4 clustering to Release 3
Buffy 2008-04-29 Release 5.5 accounting
Buffy 2008-08-15 Release 5.9 accounting
Buffy 2008-12-18 5.12 accounting

Clone Sequence Records

AT16536.complete Sequence

1074 bp (1074 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075219

> AT16536.complete
CGCTTACTTCAACTTCGGTTCAATTCATTTTCAGCCTTCGACGAGCGCGG
AACGTTTGCGGCAGCGTTTTTTGGCCGCGCTTCTCAAGTTTCAGCTCGCG
TTGGGAAATAAACGGCGATTTCCCTCAGGATCTCGAACGAGTTCGGTTGC
GCGAAACATGCCCGGCACCTCGTATCCCACGAATAACGATAATTTCAGCA
ACGGATTTCCGATGGCCACCACACAAAGTGAGCGCCTCTTGCAGGCCCAG
AATCGAAGAAAGTTCAGTTTTCCAGCCACACTACATTCCGCATCACTACT
GGAGGTGGGTGGTGGTCCCAAGGAGACCACGAGGCGTAGGTTGAGCAATG
TCAGCGATGCCGTAACCAGGAAACTCTCCTACACGATTGGCTGGAAGGCG
GCACAGATTCCAGCGCAGGATATCATTTCTCAGGGTCGTTGCCTGTGCGG
TCATTATATCAAGAGACGCCTCAGAAGATCTGGTTTGTTCAACAAAAAGC
TGGGACTGCAGCGCATACGTAGCATACTGGGCTCCACCTCCATGGGCATT
GTGCGCGATGTGTTTCCAGCGGTCCAAGTGCTGGGCGATGAACTGGAGCG
CATGCATCCCCGGATATACAACGGAGTAGCTCGTCAGATTTGTCGGAATC
CGGGTGGTGAGTTCCATACTCCGGATGCTGTGAGCTTGCTTTTGGGAGCC
GTTGGTCGCGAGCTCTTCCGGGTGGAGATTACGTGGAGCAAGGTGATCTC
TCTGTTCGCCATCGCCGGTGGGCTGTCCGTTGATTGTGTACGCCAAGGAC
ATCCGGAATACTTGCCCAAGTTGATGGAGAGCGTTTCCGAGGTGATCGAA
GATGAGCTGGTTCCGTGGATTAACGAGAATGGTGGTTGGAGTGGCATCAA
CACACACGTTTTACCCACTACCAACAGCCTGAATCCTTTAGAGTGGACCA
CTTTGGTTATAGGCGTAGTTTTTGGCCTAATTCTAGTTTTTATGATTCTG
CGATTTATATTTAACTTGATTGTACCAAAAATATACCAACGATTTACGAA
TTCCTAAAAAAAAAAAAAAAAAAA

AT16536.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Buffy-RA 1259 Buffy-RA 1..1058 1..1058 5155 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7575330..7575639 580..889 1535 99.7 Plus
chr2R 21145070 chr2R 7574728..7575048 114..434 1530 98.4 Plus
chr2R 21145070 chr2R 7575700..7575866 889..1055 835 100 Plus
chr2R 21145070 chr2R 7575122..7575270 432..580 745 100 Plus
chr2R 21145070 chr2R 7566777..7566891 1..115 530 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11688019..11688328 580..889 1535 99.7 Plus
2R 25286936 2R 11687417..11687737 114..434 1530 98.4 Plus
2R 25286936 2R 11688389..11688558 889..1058 850 100 Plus
2R 25286936 2R 11687811..11687959 432..580 745 100 Plus
2R 25286936 2R 11679473..11679587 1..115 530 97.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11689218..11689527 580..889 1535 99.6 Plus
2R 25260384 2R 11688616..11688936 114..434 1530 98.4 Plus
2R 25260384 2R 11689588..11689757 889..1058 850 100 Plus
2R 25260384 2R 11689010..11689158 432..580 745 100 Plus
2R 25260384 2R 11680672..11680786 1..115 530 97.3 Plus
Blast to na_te.dros performed on 2019-03-16 15:56:42 has no hits.

AT16536.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:57:40 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7566777..7566890 1..114 97 -> Plus
chr2R 7574729..7575047 115..433 98 -> Plus
chr2R 7575124..7575270 434..580 100 -> Plus
chr2R 7575331..7575639 581..889 99 -> Plus
chr2R 7575701..7575866 890..1055 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:08:58 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..898 158..1055 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:53:49 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..898 158..1055 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:02 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..900 158..1057 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:19:02 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..898 158..1055 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:10 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..900 158..1057 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:17:12 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..1055 1..1055 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:53:49 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..1055 1..1055 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:02 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..1036 20..1055 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:19:02 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..1055 1..1055 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:10 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
Buffy-RA 1..1036 20..1055 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:40 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11687418..11687736 115..433 98 -> Plus
2R 11687813..11687959 434..580 100 -> Plus
2R 11679473..11679586 1..114 97 -> Plus
2R 11688020..11688328 581..889 99 -> Plus
2R 11688390..11688555 890..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:40 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11687418..11687736 115..433 98 -> Plus
2R 11687813..11687959 434..580 100 -> Plus
2R 11679473..11679586 1..114 97 -> Plus
2R 11688020..11688328 581..889 99 -> Plus
2R 11688390..11688555 890..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:40 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11687418..11687736 115..433 98 -> Plus
2R 11687813..11687959 434..580 100 -> Plus
2R 11679473..11679586 1..114 97 -> Plus
2R 11688020..11688328 581..889 99 -> Plus
2R 11688390..11688555 890..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:02 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7566978..7567091 1..114 97 -> Plus
arm_2R 7574923..7575241 115..433 98 -> Plus
arm_2R 7575318..7575464 434..580 100 -> Plus
arm_2R 7575525..7575833 581..889 99 -> Plus
arm_2R 7575895..7576060 890..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:53:19 Download gff for AT16536.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11688617..11688935 115..433 98 -> Plus
2R 11689012..11689158 434..580 100 -> Plus
2R 11689219..11689527 581..889 99 -> Plus
2R 11689589..11689754 890..1055 100   Plus
2R 11680672..11680785 1..114 97 -> Plus

AT16536.hyp Sequence

Translation from 1 to 1054

> AT16536.hyp
AYFNFGSIHFQPSTSAERLRQRFSAALLKFQLALGNKRRFPSGSRTISVA
RNMPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLL
EVGGGPKETTRRRLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCG
HYIKRRLRRSGLFNKKLGLQRIRSILGSTSMGIVRDVFPAVQVLGDELER
MHPRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRVEITWSKVIS
LFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGIN
THVLPTTNSLNPLEWTTLVIGVVFGLILVFMILRFIFNLIVPKIYQRFTN
S

AT16536.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
Buffy-PA 299 CG8238-PA 1..299 53..351 1553 100 Plus
Debcl-PA 300 CG33134-PA 96..291 140..336 521 47.7 Plus

AT16536.pep Sequence

Translation from 157 to 1056

> AT16536.pep
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEV
GGGPKETTRRRLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHY
IKRRLRRSGLFNKKLGLQRIRSILGSTSMGIVRDVFPAVQVLGDELERMH
PRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRVEITWSKVISLF
AIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGINTH
VLPTTNSLNPLEWTTLVIGVVFGLILVFMILRFIFNLIVPKIYQRFTNS*

AT16536.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11452-PA 271 GF11452-PA 1..266 1..266 1397 97.7 Plus
Dana\GF11057-PA 305 GF11057-PA 101..296 88..284 527 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20214-PA 298 GG20214-PA 1..298 1..298 1564 98.7 Plus
Dere\GG23208-PA 300 GG23208-PA 96..291 88..284 531 47.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21024-PA 298 GH21024-PA 1..297 1..297 1425 89 Plus
Dgri\GH21025-PA 302 GH21025-PA 98..286 83..273 502 47.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Buffy-PA 299 CG8238-PA 1..299 1..299 1553 100 Plus
Debcl-PA 300 CG33134-PA 96..291 88..284 521 47.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18624-PA 298 GI18624-PA 1..298 1..298 1463 92 Plus
Dmoj\GI18625-PA 319 GI18625-PA 116..310 88..284 519 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10080-PA 296 GL10080-PA 1..296 1..298 1492 94.3 Plus
Dper\GL20359-PA 298 GL20359-PA 95..289 88..284 514 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20921-PA 296 GA20921-PA 1..296 1..298 1492 94.3 Plus
Dpse\GA17309-PA 298 GA17309-PA 95..289 88..284 514 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21300-PA 299 GM21300-PA 1..299 1..299 1576 99.3 Plus
Dsec\GM20882-PA 302 GM20882-PA 98..293 88..284 531 47.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10809-PA 121 GD10809-PA 1..116 1..116 621 100 Plus
Dsim\GD10412-PA 300 GD10412-PA 96..291 88..284 529 47.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21633-PA 298 GJ21633-PA 1..298 1..298 1463 92 Plus
Dvir\GJ21634-PA 315 GJ21634-PA 112..306 88..284 519 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17878-PA 298 GK17878-PA 1..298 1..298 1463 90.6 Plus
Dwil\GK19537-PA 310 GK19537-PA 107..301 88..284 519 46.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12374-PA 297 GE12374-PA 1..297 1..298 1552 98.7 Plus
Dyak\GE19062-PA 301 GE19062-PA 97..292 88..284 534 47.7 Plus