Clone AT16570 Report

Search the DGRC for AT16570

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:165
Well:70
Vector:pOTB7
Associated Gene/TranscriptCG12679-RA
Protein status:AT16570.pep: gold
Preliminary Size:573
Sequenced Size:777

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12679 2002-01-01 Sim4 clustering to Release 2
CG12679 2002-06-10 Blastp of sequenced clone
CG12679 2003-01-01 Sim4 clustering to Release 3
CG12679 2008-04-29 Release 5.5 accounting
CG12679 2008-08-15 Release 5.9 accounting
CG12679 2008-12-18 5.12 accounting

Clone Sequence Records

AT16570.complete Sequence

777 bp (777 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070794

> AT16570.complete
CCAGTCTCAAGGTAGCAACTTTCAAAATTTTTAGTTCCTGTGTTCGTAAC
AAATAAGTGAAATCGCATATCGTGATACCAGACTGACAGAATCGATAGAA
TTCTCGAAGGAACGAAGAGAAGCGCCGAAAATGCATGTGGTGGGGGCACT
GGTCAATCTGCTGCTGATCTTGGCCTGCATTTACACGATGACCTCACTGA
CCCCGGCGGACCATCCGTATGCCTTCCTGGCGGCATCCTTCAGCCTGGTC
CACGGAGTGCTGGGCGTGGTTCGCTCCTTTGCCAACGAGCCCGACGAGTG
CGGACGCACCTTTATGATCTCAGCCATCATACTGGAGGTTATCCCGCTGC
CACTGGCGAACATCGAGTTCTACCTGGTATCCGATCAGTCGGGAGTGGCG
CTGGTGCACGGCCTGTCGTTGATTCCACTGTTCTACGACATGATCGGCAA
GATCAGCGAGGACTGGGACAGCTCCACGGAGACGCTGATGGACCTCGCTC
TGTTGGGCAACATCGGCTCCACGTTGTATCTGGCCATCAAGGACGGCAAC
CATATCTACTTCGGTGTGGCTGCCACCGCGCTCCTCGCCAGATACGGCGG
TGCAATTGTCGATAGCTGCAACGAGGGCCTTAGCAACGTTGTAGAGACTC
TGGGAAACACCGGCATCCTGGCCCTTATGACCTACGCACTCACTGAGGGC
TAATTGCTAAAACTTAAATTTGATCGGTTCGCGAAATAAAGCCAAGATGA
TGAATCAGCAAAAAAAAAAAAAAAAAA

AT16570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12679-RA 759 CG12679-RA 1..759 1..759 3795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20241200..20241958 759..1 3795 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20375763..20376522 760..1 3800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20360855..20361614 760..1 3800 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:56:49 has no hits.

AT16570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:57:44 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20241200..20241958 1..759 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:09:05 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..573 131..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:23 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..573 131..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:16 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..573 131..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:53 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..573 131..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:18 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..573 131..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:12 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:23 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:16 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:53 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:18 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
CG12679-RA 1..759 1..759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:44 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
X 20375764..20376522 1..759 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:44 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
X 20375764..20376522 1..759 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:44 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
X 20375764..20376522 1..759 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:16 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20246791..20247549 1..759 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:06 Download gff for AT16570.complete
Subject Subject Range Query Range Percent Splice Strand
X 20360856..20361614 1..759 100   Minus

AT16570.pep Sequence

Translation from 130 to 702

> AT16570.pep
MHVVGALVNLLLILACIYTMTSLTPADHPYAFLAASFSLVHGVLGVVRSF
ANEPDECGRTFMISAIILEVIPLPLANIEFYLVSDQSGVALVHGLSLIPL
FYDMIGKISEDWDSSTETLMDLALLGNIGSTLYLAIKDGNHIYFGVAATA
LLARYGGAIVDSCNEGLSNVVETLGNTGILALMTYALTEG*

AT16570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20145-PA 190 GF20145-PA 1..189 1..189 660 66.7 Plus
Dana\GF19608-PA 190 GF19608-PA 1..188 1..188 413 44.7 Plus
Dana\GF21789-PA 200 GF21789-PA 7..197 4..188 228 32.8 Plus
Dana\GF21842-PA 203 GF21842-PA 33..198 27..187 200 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10445-PA 190 GG10445-PA 1..190 1..190 791 79.5 Plus
Dere\GG18584-PA 189 GG18584-PA 1..186 1..187 379 42.8 Plus
Dere\GG18583-PA 200 GG18583-PA 7..197 4..188 239 34.4 Plus
Dere\GG10502-PA 205 GG10502-PA 15..198 9..187 208 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16031-PA 188 GH16031-PA 5..187 6..189 409 44 Plus
Dgri\GH12189-PA 191 GH12189-PA 1..188 1..188 381 42.6 Plus
Dgri\GH12188-PA 198 GH12188-PA 7..179 4..172 242 34.3 Plus
Dgri\GH12187-PA 198 GH12187-PA 7..179 4..172 242 34.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12679-PA 190 CG12679-PA 1..190 1..190 959 100 Plus
CG14269-PB 190 CG14269-PB 1..188 1..188 395 42.6 Plus
CG14269-PA 190 CG14269-PA 1..188 1..188 395 42.6 Plus
CG16782-PA 200 CG16782-PA 7..197 4..188 247 32.3 Plus
CG14537-PA 203 CG14537-PA 15..198 9..187 234 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12294-PA 187 GI12294-PA 3..186 4..188 439 49.7 Plus
Dmoj\GI14347-PA 191 GI14347-PA 1..188 1..188 394 45.2 Plus
Dmoj\GI14346-PA 197 GI14346-PA 7..193 4..187 246 32.4 Plus
Dmoj\GI17049-PA 214 GI17049-PA 27..186 21..165 175 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25846-PA 189 GL25846-PA 1..187 1..188 377 42 Plus
Dper\GL21045-PA 175 GL21045-PA 1..171 20..188 372 50 Plus
Dper\GL12881-PA 197 GL12881-PA 7..193 4..187 233 31.9 Plus
Dper\GL18648-PA 202 GL18648-PA 12..199 6..187 176 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25469-PA 189 GA25469-PA 1..187 1..188 382 43.1 Plus
Dpse\GA29046-PA 176 GA29046-PA 1..172 20..188 377 49.7 Plus
Dpse\GA22616-PA 177 GA22616-PA 1..142 1..142 273 40.8 Plus
Dpse\GA14144-PA 197 GA14144-PA 7..193 4..187 224 30.9 Plus
Dpse\GA25738-PA 202 GA25738-PA 12..199 6..187 176 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24886-PA 191 GM24886-PA 1..187 1..187 822 85 Plus
Dsec\GM22678-PA 186 GM22678-PA 1..182 1..187 767 82.4 Plus
Dsec\GM18835-PA 190 GM18835-PA 1..188 1..188 403 43.1 Plus
Dsec\GM12727-PA 200 GM12727-PA 7..197 4..188 236 32.8 Plus
Dsec\GM16621-PA 203 GM16621-PA 15..198 9..187 219 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21775-PA 188 GD21775-PA 1..184 1..187 793 83.4 Plus
Dsim\GD15540-PA 186 GD15540-PA 1..182 1..187 772 82.4 Plus
Dsim\GD16333-PA 190 GD16333-PA 1..188 1..188 407 43.6 Plus
Dsim\GD16332-PA 200 GD16332-PA 7..197 4..188 236 32.8 Plus
Dsim\GD23493-PA 203 GD23493-PA 15..198 9..187 226 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13231-PA 192 GJ13231-PA 7..190 6..188 464 51.4 Plus
Dvir\GJ19395-PA 191 GJ19395-PA 1..188 1..188 391 44.1 Plus
Dvir\GJ19394-PA 197 GJ19394-PA 7..193 4..187 239 30.3 Plus
Dvir\GJ10100-PA 220 GJ10100-PA 15..192 9..165 182 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14574-PA 195 GK14574-PA 1..194 1..189 507 59.3 Plus
Dwil\GK10152-PA 192 GK10152-PA 1..188 1..188 358 39.9 Plus
Dwil\GK10151-PA 199 GK10151-PA 9..196 4..188 250 33.9 Plus
Dwil\GK23972-PA 205 GK23972-PA 15..200 9..189 226 33.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15354-PA 190 GE15354-PA 1..190 1..190 836 84.2 Plus
Dyak\GE16896-PA 190 GE16896-PA 1..188 1..188 403 43.1 Plus
Dyak\GE16895-PA 200 GE16895-PA 7..197 4..188 232 31.8 Plus
Dyak\GE14641-PA 203 GE14641-PA 15..198 9..187 212 31.2 Plus

AT16570.hyp Sequence

Translation from 130 to 702

> AT16570.hyp
MHVVGALVNLLLILACIYTMTSLTPADHPYAFLAASFSLVHGVLGVVRSF
ANEPDECGRTFMISAIILEVIPLPLANIEFYLVSDQSGVALVHGLSLIPL
FYDMIGKISEDWDSSTETLMDLALLGNIGSTLYLAIKDGNHIYFGVAATA
LLARYGGAIVDSCNEGLSNVVETLGNTGILALMTYALTEG*

AT16570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12679-PA 190 CG12679-PA 1..190 1..190 959 100 Plus
CG14269-PB 190 CG14269-PB 1..188 1..188 395 42.6 Plus
CG14269-PA 190 CG14269-PA 1..188 1..188 395 42.6 Plus
CG16782-PA 200 CG16782-PA 7..197 4..188 247 32.3 Plus
CG14537-PA 203 CG14537-PA 15..198 9..187 234 31.9 Plus