AT16918.complete Sequence
623 bp (623 high quality bases) assembled on 2002-09-11
GenBank Submission: BT001325
> AT16918.complete
GAATCTCAGTAGTCTTTCCGGCGTACATCCCAATTACTTGGGATTACAAA
ATTATCCAAATTTGTCATACTTTTGAGCCATGATCAATATTCTTAGGACA
CTGTCAGGCAGAGGTCTTCAACTCACCAGGAGACTTCATCGACGACCCCA
GATCTGCCAGAAGCCCGGAGTCTTTGTCCATCCGGAGCTGCGTCGCACTA
TTCCCCTCGTTTACTTCAGCAAAGGGGAACTGCCACCTAAACCGAATCAA
GAAGTCTCATCCAACCGGCAGTGCGAAATATCTCCTTCGGAGAAGAATCG
AAAAAGCACGGAGGCCTTTGATCAGTTTTGTAAAAGACAACGGCAATGCT
TTTCCAGCACCTACCAGTGGGCAGAGTTCCGGCGAAAGATGATCTATGGC
AGTTACTAGTATGAAGCCACCCAGAAAGGACCAAATCCAGTGAAAGACTC
CTTTTTATTCATTAGCCCCTGCATTGTGACTTAAAAAGTGTTTTGTTTGG
ATCTAATTCGCCAGCGAAGTAATAACAAGAGGCTTTATAAGCCACAATGC
ACTGCAGTCTGAAATGCATAGTTGAATTCAAGCAATAAAACAGGATAACA
TAGATAAAAAAAAAAAAAAAAAA
AT16918.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:42:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12126-RA | 591 | CG12126-RA | 1..591 | 1..591 | 2940 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:04:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 4150169..4150773 | 605..1 | 3010 | 99.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8262672..8263278 | 607..1 | 3020 | 99.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 8263871..8264477 | 607..1 | 3020 | 99.8 | Minus |
Blast to na_te.dros performed on 2019-03-16 06:04:06 has no hits.
AT16918.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:42 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 4150169..4150773 | 1..605 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:10:09 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..330 | 80..409 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:23 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..330 | 80..409 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:27 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..330 | 80..409 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:20 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..330 | 80..409 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:02 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..330 | 80..409 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:38:59 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..591 | 1..591 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:23 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..605 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:27 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..605 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:20 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..591 | 1..591 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:02 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12126-RA | 1..605 | 1..605 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8262674..8263278 | 1..605 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8262674..8263278 | 1..605 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8262674..8263278 | 1..605 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:27 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4150179..4150783 | 1..605 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:17 Download gff for
AT16918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8263873..8264477 | 1..605 | 99 | | Minus |
AT16918.hyp Sequence
Translation from 79 to 408
> AT16918.hyp
MINILRTLSGRGLQLTRRLHRRPQICQKPGVFVHPELRRTIPLVYFSKGE
LPPKPNQEVSSNRQCEISPSEKNRKSTEAFDQFCKRQRQCFSSTYQWAEF
RRKMIYGSY*
AT16918.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:00:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12126-PA | 109 | CG12126-PA | 1..109 | 1..109 | 583 | 100 | Plus |
AT16918.pep Sequence
Translation from 79 to 408
> AT16918.pep
MINILRTLSGRGLQLTRRLHRRPQICQKPGVFVHPELRRTIPLVYFSKGE
LPPKPNQEVSSNRQCEISPSEKNRKSTEAFDQFCKRQRQCFSSTYQWAEF
RRKMIYGSY*
AT16918.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:44:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12601-PA | 117 | GF12601-PA | 37..116 | 34..109 | 163 | 40 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:44:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10660-PA | 109 | GG10660-PA | 1..109 | 1..109 | 465 | 78.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12126-PA | 109 | CG12126-PA | 1..109 | 1..109 | 583 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:44:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10877-PA | 91 | GL10877-PA | 17..91 | 10..109 | 132 | 33 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:44:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11420-PA | 91 | GA11420-PA | 17..91 | 10..109 | 132 | 33 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:44:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20705-PA | 109 | GM20705-PA | 1..109 | 1..109 | 524 | 90.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:44:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15287-PA | 109 | GD15287-PA | 1..109 | 1..109 | 529 | 91.7 | Plus |
Dsim\GD10175-PA | 109 | GD10175-PA | 1..109 | 1..109 | 526 | 90.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:44:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23180-PA | 109 | GE23180-PA | 1..109 | 1..109 | 434 | 75.2 | Plus |