Clone AT16918 Report

Search the DGRC for AT16918

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:169
Well:18
Vector:pOTB7
Associated Gene/TranscriptCG12126-RA
Protein status:AT16918.pep: gold
Preliminary Size:591
Sequenced Size:623

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12126 2002-09-11 Blastp of sequenced clone
CG12126 2003-01-01 Sim4 clustering to Release 3
CG12126 2008-04-29 Release 5.5 accounting
CG12126 2008-08-15 Release 5.9 accounting
CG12126 2008-12-18 5.12 accounting

Clone Sequence Records

AT16918.complete Sequence

623 bp (623 high quality bases) assembled on 2002-09-11

GenBank Submission: BT001325

> AT16918.complete
GAATCTCAGTAGTCTTTCCGGCGTACATCCCAATTACTTGGGATTACAAA
ATTATCCAAATTTGTCATACTTTTGAGCCATGATCAATATTCTTAGGACA
CTGTCAGGCAGAGGTCTTCAACTCACCAGGAGACTTCATCGACGACCCCA
GATCTGCCAGAAGCCCGGAGTCTTTGTCCATCCGGAGCTGCGTCGCACTA
TTCCCCTCGTTTACTTCAGCAAAGGGGAACTGCCACCTAAACCGAATCAA
GAAGTCTCATCCAACCGGCAGTGCGAAATATCTCCTTCGGAGAAGAATCG
AAAAAGCACGGAGGCCTTTGATCAGTTTTGTAAAAGACAACGGCAATGCT
TTTCCAGCACCTACCAGTGGGCAGAGTTCCGGCGAAAGATGATCTATGGC
AGTTACTAGTATGAAGCCACCCAGAAAGGACCAAATCCAGTGAAAGACTC
CTTTTTATTCATTAGCCCCTGCATTGTGACTTAAAAAGTGTTTTGTTTGG
ATCTAATTCGCCAGCGAAGTAATAACAAGAGGCTTTATAAGCCACAATGC
ACTGCAGTCTGAAATGCATAGTTGAATTCAAGCAATAAAACAGGATAACA
TAGATAAAAAAAAAAAAAAAAAA

AT16918.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG12126-RA 591 CG12126-RA 1..591 1..591 2940 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4150169..4150773 605..1 3010 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8262672..8263278 607..1 3020 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8263871..8264477 607..1 3020 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 06:04:06 has no hits.

AT16918.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:42 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4150169..4150773 1..605 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:10:09 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..330 80..409 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:23 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..330 80..409 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:27 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..330 80..409 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:20 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..330 80..409 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:02 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..330 80..409 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:38:59 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..591 1..591 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:23 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..605 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:27 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..605 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:20 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..591 1..591 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:02 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
CG12126-RA 1..605 1..605 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8262674..8263278 1..605 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8262674..8263278 1..605 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:42 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8262674..8263278 1..605 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:27 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4150179..4150783 1..605 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:17 Download gff for AT16918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8263873..8264477 1..605 99   Minus

AT16918.hyp Sequence

Translation from 79 to 408

> AT16918.hyp
MINILRTLSGRGLQLTRRLHRRPQICQKPGVFVHPELRRTIPLVYFSKGE
LPPKPNQEVSSNRQCEISPSEKNRKSTEAFDQFCKRQRQCFSSTYQWAEF
RRKMIYGSY*

AT16918.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12126-PA 109 CG12126-PA 1..109 1..109 583 100 Plus

AT16918.pep Sequence

Translation from 79 to 408

> AT16918.pep
MINILRTLSGRGLQLTRRLHRRPQICQKPGVFVHPELRRTIPLVYFSKGE
LPPKPNQEVSSNRQCEISPSEKNRKSTEAFDQFCKRQRQCFSSTYQWAEF
RRKMIYGSY*

AT16918.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12601-PA 117 GF12601-PA 37..116 34..109 163 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10660-PA 109 GG10660-PA 1..109 1..109 465 78.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12126-PA 109 CG12126-PA 1..109 1..109 583 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10877-PA 91 GL10877-PA 17..91 10..109 132 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11420-PA 91 GA11420-PA 17..91 10..109 132 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20705-PA 109 GM20705-PA 1..109 1..109 524 90.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15287-PA 109 GD15287-PA 1..109 1..109 529 91.7 Plus
Dsim\GD10175-PA 109 GD10175-PA 1..109 1..109 526 90.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23180-PA 109 GE23180-PA 1..109 1..109 434 75.2 Plus