Clone AT17033 Report

Search the DGRC for AT17033

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:170
Well:33
Vector:pOTB7
Associated Gene/TranscriptCG17376-RA
Protein status:AT17033.pep: gold
Sequenced Size:472

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17376-RA 2010-01-13 Manual selection by Sue Celniker

Clone Sequence Records

AT17033.complete Sequence

472 bp assembled on 2010-02-10

GenBank Submission: BT120311.1

> AT17033.complete
CTCGGACCAGTCGCTTCGACTTCTAAATTTTTTTCTAAATTCCAAATTTA
CTTTTTCGAGAATAACTCAACCAAAAAACGTTAGACAAACTCAACATGTG
CAACGGATGTGGATGCTGTGGACCCTCTCCTTGCCCCAGGCGTTACCTTG
TTAACAAGGATAACGCGCCTTGCGTGTGGTGTGCTCCGTGCAAAGCCCAC
TGCTACAACACTCCGCCAAAATGCTGTTGCTAGGTTTAGCCACCGACTCT
GGTCCTAATCCTTTCCACTCCACACATTTGTGGCTTCTAAGCGGCTCTGT
TACTACGGACGACCCATATAAGCGGCGGAACTGAGAACCGTTGGACCATG
TTGTGTAACACGTTTTGGTTAGCAACTCGATCAGATGCAGCTATCACCAA
TATGCAGATTTTTAGGCTTTAAATATTAATAAATATAAGAAATCGAAAAA
AAAAAAAAAAAAAAAAAAAAAA

AT17033.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17376-RA 538 CG17376-RA 89..535 1..447 2190 99.3 Plus
CG17376.a 388 CG17376.a 22..388 79..445 1805 99.4 Plus
CG17376-RB 547 CG17376-RB 376..544 279..447 815 98.8 Plus
CG17376-RB 547 CG17376-RB 89..214 1..126 615 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6798997..6799162 445..280 830 100 Minus
chr2L 23010047 chr2L 6799212..6799366 281..127 775 100 Minus
chr2L 23010047 chr2L 6799804..6799881 78..1 390 100 Minus
chr2L 23010047 chr2L 6799702..6799749 126..79 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6799944..6800111 447..280 810 98.8 Minus
2L 23513712 2L 6800161..6800315 281..127 775 100 Minus
2L 23513712 2L 6800753..6800830 78..1 375 98.7 Minus
2L 23513712 2L 6800651..6800698 126..79 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6799944..6800111 447..280 810 98.8 Minus
2L 23513712 2L 6800161..6800315 281..127 775 100 Minus
2L 23513712 2L 6800753..6800830 78..1 375 98.7 Minus
2L 23513712 2L 6800651..6800698 126..79 240 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:48:01 has no hits.

AT17033.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:01 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6799214..6799366 127..279 100 <- Minus
chr2L 6799702..6799749 79..126 100 <- Minus
chr2L 6799804..6799881 1..78 100   Minus
chr2L 6799027..6799162 280..415 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-10 18:30:27 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 1..138 96..233 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:14 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 1..138 96..233 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:39:44 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 1..138 96..233 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:38 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 1..138 96..233 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-10 18:30:24 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 5..449 1..445 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:13 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 5..449 1..445 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:39:44 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 5..449 1..445 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:38 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 5..449 1..445 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6799946..6800111 280..445 98 <- Minus
2L 6800163..6800315 127..279 100 <- Minus
2L 6800651..6800698 79..126 100 <- Minus
2L 6800753..6800830 1..78 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6799946..6800111 280..445 98 <- Minus
2L 6800163..6800315 127..279 100 <- Minus
2L 6800651..6800698 79..126 100 <- Minus
2L 6800753..6800830 1..78 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6799946..6800111 280..445 98 <- Minus
2L 6800163..6800315 127..279 100 <- Minus
2L 6800651..6800698 79..126 100 <- Minus
2L 6800753..6800830 1..78 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:39:44 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6799946..6800111 280..445 98 <- Minus
arm_2L 6800163..6800315 127..279 100 <- Minus
arm_2L 6800651..6800698 79..126 100 <- Minus
arm_2L 6800753..6800830 1..78 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:50 Download gff for AT17033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6800163..6800315 127..279 100 <- Minus
2L 6800651..6800698 79..126 100 <- Minus
2L 6800753..6800830 1..78 98   Minus
2L 6799946..6800111 280..445 98 <- Minus

AT17033.hyp Sequence

Translation from 1 to 153

> AT17033.hyp
SDQSLRLLNFFLNSKFTFSIITQPKNVRQTQHVQRMWMLWTLSLPQALPC
*
Sequence AT17033.hyp has no blast hits.

AT17033.pep Sequence

Translation from 95 to 232

> AT17033.pep
MCNGCGCCGPSPCPRRYLVNKDNAPCVWCAPCKAHCYNTPPKCCC*

AT17033.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23579-PA 45 GG23579-PA 1..45 1..45 220 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13712-PA 38 GH13712-PA 5..38 13..45 130 82.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17376-PA 45 CG17376-PA 1..45 1..45 301 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25611-PA 134 GL25611-PA 95..134 7..45 149 82.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28050-PA 134 GA28050-PA 95..134 7..45 149 82.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13814-PA 45 GM13814-PA 1..45 1..45 220 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22538-PA 45 GD22538-PA 1..45 1..45 220 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17576-PA 52 GJ17576-PA 23..52 16..45 140 93.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18401-PA 45 GE18401-PA 1..45 1..45 220 100 Plus