AT17033.complete Sequence
472 bp assembled on 2010-02-10
GenBank Submission: BT120311.1
> AT17033.complete
CTCGGACCAGTCGCTTCGACTTCTAAATTTTTTTCTAAATTCCAAATTTA
CTTTTTCGAGAATAACTCAACCAAAAAACGTTAGACAAACTCAACATGTG
CAACGGATGTGGATGCTGTGGACCCTCTCCTTGCCCCAGGCGTTACCTTG
TTAACAAGGATAACGCGCCTTGCGTGTGGTGTGCTCCGTGCAAAGCCCAC
TGCTACAACACTCCGCCAAAATGCTGTTGCTAGGTTTAGCCACCGACTCT
GGTCCTAATCCTTTCCACTCCACACATTTGTGGCTTCTAAGCGGCTCTGT
TACTACGGACGACCCATATAAGCGGCGGAACTGAGAACCGTTGGACCATG
TTGTGTAACACGTTTTGGTTAGCAACTCGATCAGATGCAGCTATCACCAA
TATGCAGATTTTTAGGCTTTAAATATTAATAAATATAAGAAATCGAAAAA
AAAAAAAAAAAAAAAAAAAAAA
AT17033.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:44:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17376-RA | 538 | CG17376-RA | 89..535 | 1..447 | 2190 | 99.3 | Plus |
CG17376.a | 388 | CG17376.a | 22..388 | 79..445 | 1805 | 99.4 | Plus |
CG17376-RB | 547 | CG17376-RB | 376..544 | 279..447 | 815 | 98.8 | Plus |
CG17376-RB | 547 | CG17376-RB | 89..214 | 1..126 | 615 | 99.2 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 6798997..6799162 | 445..280 | 830 | 100 | Minus |
chr2L | 23010047 | chr2L | 6799212..6799366 | 281..127 | 775 | 100 | Minus |
chr2L | 23010047 | chr2L | 6799804..6799881 | 78..1 | 390 | 100 | Minus |
chr2L | 23010047 | chr2L | 6799702..6799749 | 126..79 | 240 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6799944..6800111 | 447..280 | 810 | 98.8 | Minus |
2L | 23513712 | 2L | 6800161..6800315 | 281..127 | 775 | 100 | Minus |
2L | 23513712 | 2L | 6800753..6800830 | 78..1 | 375 | 98.7 | Minus |
2L | 23513712 | 2L | 6800651..6800698 | 126..79 | 240 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6799944..6800111 | 447..280 | 810 | 98.8 | Minus |
2L | 23513712 | 2L | 6800161..6800315 | 281..127 | 775 | 100 | Minus |
2L | 23513712 | 2L | 6800753..6800830 | 78..1 | 375 | 98.7 | Minus |
2L | 23513712 | 2L | 6800651..6800698 | 126..79 | 240 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 07:48:01 has no hits.
AT17033.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:01 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 6799214..6799366 | 127..279 | 100 | <- | Minus |
chr2L | 6799702..6799749 | 79..126 | 100 | <- | Minus |
chr2L | 6799804..6799881 | 1..78 | 100 | | Minus |
chr2L | 6799027..6799162 | 280..415 | 100 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-10 18:30:27 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 1..138 | 96..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:14 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 1..138 | 96..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:39:44 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 1..138 | 96..233 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:38 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 1..138 | 96..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-10 18:30:24 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 5..449 | 1..445 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:13 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 5..449 | 1..445 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:39:44 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 5..449 | 1..445 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:38 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 5..449 | 1..445 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6799946..6800111 | 280..445 | 98 | <- | Minus |
2L | 6800163..6800315 | 127..279 | 100 | <- | Minus |
2L | 6800651..6800698 | 79..126 | 100 | <- | Minus |
2L | 6800753..6800830 | 1..78 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6799946..6800111 | 280..445 | 98 | <- | Minus |
2L | 6800163..6800315 | 127..279 | 100 | <- | Minus |
2L | 6800651..6800698 | 79..126 | 100 | <- | Minus |
2L | 6800753..6800830 | 1..78 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:01 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6799946..6800111 | 280..445 | 98 | <- | Minus |
2L | 6800163..6800315 | 127..279 | 100 | <- | Minus |
2L | 6800651..6800698 | 79..126 | 100 | <- | Minus |
2L | 6800753..6800830 | 1..78 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:39:44 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6799946..6800111 | 280..445 | 98 | <- | Minus |
arm_2L | 6800163..6800315 | 127..279 | 100 | <- | Minus |
arm_2L | 6800651..6800698 | 79..126 | 100 | <- | Minus |
arm_2L | 6800753..6800830 | 1..78 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:50 Download gff for
AT17033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6800163..6800315 | 127..279 | 100 | <- | Minus |
2L | 6800651..6800698 | 79..126 | 100 | <- | Minus |
2L | 6800753..6800830 | 1..78 | 98 | | Minus |
2L | 6799946..6800111 | 280..445 | 98 | <- | Minus |
AT17033.hyp Sequence
Translation from 1 to 153
> AT17033.hyp
SDQSLRLLNFFLNSKFTFSIITQPKNVRQTQHVQRMWMLWTLSLPQALPC
*
Sequence AT17033.hyp has no blast hits.
AT17033.pep Sequence
Translation from 95 to 232
> AT17033.pep
MCNGCGCCGPSPCPRRYLVNKDNAPCVWCAPCKAHCYNTPPKCCC*
AT17033.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23579-PA | 45 | GG23579-PA | 1..45 | 1..45 | 220 | 100 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH13712-PA | 38 | GH13712-PA | 5..38 | 13..45 | 130 | 82.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17376-PA | 45 | CG17376-PA | 1..45 | 1..45 | 301 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:09:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25611-PA | 134 | GL25611-PA | 95..134 | 7..45 | 149 | 82.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:09:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28050-PA | 134 | GA28050-PA | 95..134 | 7..45 | 149 | 82.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:09:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13814-PA | 45 | GM13814-PA | 1..45 | 1..45 | 220 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:09:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22538-PA | 45 | GD22538-PA | 1..45 | 1..45 | 220 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:09:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17576-PA | 52 | GJ17576-PA | 23..52 | 16..45 | 140 | 93.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:09:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18401-PA | 45 | GE18401-PA | 1..45 | 1..45 | 220 | 100 | Plus |