Clone AT17318 Report

Search the DGRC for AT17318

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:173
Well:18
Vector:pOTB7
Associated Gene/TranscriptCG8349-RA
Protein status:AT17318.pep: gold
Preliminary Size:795
Sequenced Size:942

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8349 2002-01-01 Sim4 clustering to Release 2
CG8349 2003-01-01 Sim4 clustering to Release 3
CG8349 2003-01-22 Blastp of sequenced clone
CG8349 2008-04-29 Release 5.5 accounting
CG8349 2008-08-15 Release 5.9 accounting
CG8349 2008-12-18 5.12 accounting

Clone Sequence Records

AT17318.complete Sequence

942 bp (942 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075221

> AT17318.complete
CAGATACAGCATTTGCTTCTGGCTTTCAAAAATTGTTTTCGTTTTAAAAA
TTTGAAGTTCTGCAAAATGTCCGAAAAGCGGAAGCTCCTTCAGCGCTACA
TGCGGAACCTGAGCGACCTACAGGATGAGCTGAAGCGAAAAGAGCTGGAG
AAGAAGATGAAGGAACTGGAAATGTTGCAGGCGAAGCTAGCTCGTCGCCA
GGAGCAATCTGGCACCAAGTGCGCTGGCGGTAAGATCAAAAACTTGCGCC
AGAAGAATCTTCGAAAGGTACTGGGAAAGTATATGATGACCTTGGAGGGA
TTTCTATGCGAGCTGGCCCGCAGGGAGGCGCGTCTAAATGGCGACAGGGG
TCGGGCTAGTGAATCCGAAAACCTGCCACATCCACAGATGTTGGAGGAGT
ACACAGTAGCGTTCTGTGCTGTTGGTGAGGATGGCCGGGAGCTGCTAGAG
GCGGCTCTTTCTGCCCGTCGATGTGCCTATGCGCCCTACAGCAAATTCAA
AGTGGGAGCAGCCTTCCGTGCGAAGTGCGGCAGGATATACGCGGGCTGCA
ACATCGAGAACGTAGCTTTCACTCCAGGCAATTGTGCGGAGCGTTGTGCC
CTGGCCAAGGGTATCAGCGAGGGCGAGAAGAAGTATACGGCGGGTGCTGT
GGTAGCCTATCACCCAGATGGGTTTACCACACCTTGCGGAGTCTGCCGGC
AGTTCATTTTGGAGTTCATCCAAAATGATATTCCTATCTACATTGCCAAG
GCTCCGCCGCCGGAGCAAGAGAACTGCATTCCTTCAATTCCGGACGAAGC
TGAAGTGCTGGTCACGTCCGCCTACCATCTGCTTCCCCACAGCTTTAACT
CATTTGAATGAAATGTTCTTCTAAATAATATCCAGAATTTATTTAATGCA
ATAAAATTATTCGTTCTAATGTCAAAAAAAAAAAAAAAAAAA

AT17318.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8349-RA 938 CG8349-RA 16..938 1..923 4525 99.3 Plus
CG8292-RA 1106 CG8292-RA 1054..1106 925..873 265 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8215378..8215877 424..923 2455 99.4 Plus
chr2L 23010047 chr2L 8214896..8215325 1..430 2090 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8216402..8216903 424..925 2465 99.4 Plus
2L 23513712 2L 8215920..8216349 1..430 2090 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8216402..8216903 424..925 2465 99.4 Plus
2L 23513712 2L 8215920..8216349 1..430 2090 99 Plus
Blast to na_te.dros performed on 2019-03-16 19:01:37 has no hits.

AT17318.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:22 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8214896..8215319 1..424 99 -> Plus
chr2L 8215379..8215877 425..923 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:10:38 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 1..795 67..861 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:30 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 1..795 67..861 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:29 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 1..795 67..861 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:28 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 1..795 67..861 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:16 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 1..795 67..861 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:51 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 6..928 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:29 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 6..928 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:29 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 6..928 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:29 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 6..928 1..923 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:16 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
CG8349-RA 6..928 1..923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:22 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8215920..8216343 1..424 99 -> Plus
2L 8216403..8216901 425..923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:22 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8215920..8216343 1..424 99 -> Plus
2L 8216403..8216901 425..923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:22 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8215920..8216343 1..424 99 -> Plus
2L 8216403..8216901 425..923 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:29 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8215920..8216343 1..424 99 -> Plus
arm_2L 8216403..8216901 425..923 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:37 Download gff for AT17318.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8215920..8216343 1..424 99 -> Plus
2L 8216403..8216901 425..923 99   Plus

AT17318.hyp Sequence

Translation from 1 to 860

> AT17318.hyp
QIQHLLLAFKNCFRFKNLKFCKMSEKRKLLQRYMRNLSDLQDELKRKELE
KKMKELEMLQAKLARRQEQSGTKCAGGKIKNLRQKNLRKVLGKYMMTLEG
FLCELARREARLNGDRGRASESENLPHPQMLEEYTVAFCAVGEDGRELLE
AALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCA
LAKGISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAK
APPPEQENCIPSIPDEAEVLVTSAYHLLPHSFNSFE*

AT17318.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8349-PA 264 CG8349-PA 1..264 23..286 1381 100 Plus
CG8353-PB 170 CG8353-PB 5..168 122..285 416 51.5 Plus
CG8353-PA 170 CG8353-PA 5..168 122..285 416 51.5 Plus
CG8360-PC 158 CG8360-PC 26..153 146..283 317 50.4 Plus
CG8360-PA 158 CG8360-PA 26..153 146..283 317 50.4 Plus

AT17318.pep Sequence

Translation from 66 to 860

> AT17318.pep
MSEKRKLLQRYMRNLSDLQDELKRKELEKKMKELEMLQAKLARRQEQSGT
KCAGGKIKNLRQKNLRKVLGKYMMTLEGFLCELARREARLNGDRGRASES
ENLPHPQMLEEYTVAFCAVGEDGRELLEAALSARRCAYAPYSKFKVGAAF
RAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKKYTAGAVVAYHP
DGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEVLVT
SAYHLLPHSFNSFE*

AT17318.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15275-PA 264 GF15275-PA 1..264 1..264 1028 73.9 Plus
Dana\GF15274-PA 170 GF15274-PA 5..168 100..263 416 52.1 Plus
Dana\GF15273-PA 158 GF15273-PA 26..153 124..261 326 52.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10527-PA 264 GG10527-PA 1..264 1..264 1315 92.8 Plus
Dere\GG10526-PA 170 GG10526-PA 5..168 100..263 425 52.7 Plus
Dere\GG10525-PA 158 GG10525-PA 26..153 124..261 320 51.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11515-PA 221 GH11515-PA 4..218 23..260 589 53.8 Plus
Dgri\GH11514-PA 168 GH11514-PA 13..168 109..263 391 51.9 Plus
Dgri\GH11513-PA 159 GH11513-PA 26..154 124..261 294 51.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG8349-PA 264 CG8349-PA 1..264 1..264 1381 100 Plus
CG8353-PB 170 CG8353-PB 5..168 100..263 416 51.5 Plus
CG8353-PA 170 CG8353-PA 5..168 100..263 416 51.5 Plus
CG8360-PC 158 CG8360-PC 26..153 124..261 317 50.4 Plus
CG8360-PA 158 CG8360-PA 26..153 124..261 317 50.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17011-PA 220 GI17011-PA 4..219 23..261 586 54.8 Plus
Dmoj\GI17010-PA 173 GI17010-PA 13..173 109..264 389 49.1 Plus
Dmoj\GI17009-PA 159 GI17009-PA 26..154 124..261 313 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18731-PA 227 GL18731-PA 1..227 1..264 724 55.5 Plus
Dper\GL18730-PA 170 GL18730-PA 6..168 101..263 407 51.8 Plus
Dper\GL18729-PA 158 GL18729-PA 26..152 124..260 321 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21010-PA 227 GA21010-PA 4..227 23..264 720 58.8 Plus
Dpse\GA21012-PA 170 GA21012-PA 6..169 101..264 411 51.5 Plus
Dpse\GA21017-PA 158 GA21017-PA 26..152 124..260 321 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16862-PA 264 GM16862-PA 1..264 1..264 1354 96.2 Plus
Dsec\GM16858-PA 170 GM16858-PA 5..168 100..263 417 52.1 Plus
Dsec\GM16857-PA 158 GM16857-PA 26..153 124..261 312 50.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23517-PA 264 GD23517-PA 1..264 1..264 1353 96.2 Plus
Dsim\GD23516-PA 170 GD23516-PA 5..168 100..263 421 52.7 Plus
Dsim\GD23515-PA 158 GD23515-PA 26..153 124..261 320 51.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24367-PA 221 GJ24367-PA 4..221 23..263 600 54.4 Plus
Dvir\GJ24356-PA 167 GJ24356-PA 8..167 103..263 388 51.5 Plus
Dvir\GJ24345-PA 159 GJ24345-PA 26..153 124..260 319 51.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15160-PA 216 GK15160-PA 5..213 60..264 656 61.6 Plus
Dwil\GK15159-PA 170 GK15159-PA 6..168 101..263 394 51.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18747-PA 264 GE18747-PA 1..264 1..264 1322 93.9 Plus
Dyak\GE18746-PA 170 GE18746-PA 5..168 100..263 419 52.1 Plus
Dyak\GE18745-PA 158 GE18745-PA 26..153 124..261 320 51.1 Plus