Clone AT17601 Report

Search the DGRC for AT17601

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:176
Well:1
Vector:pOTB7
Associated Gene/TranscriptProsalpha7-RB
Protein status:AT17601.pep: validated full length
Preliminary Size:983
Sequenced Size:913

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1519 2004-05-03 Blastp of sequenced clone
Prosalpha7 2008-04-29 Release 5.5 accounting
Prosalpha7 2008-08-15 Release 5.9 accounting
Prosalpha7 2008-12-18 5.12 accounting

Clone Sequence Records

AT17601.complete Sequence

913 bp (913 high quality bases) assembled on 2004-05-03

GenBank Submission: BT014669

> AT17601.complete
AGTAAAAGCCGTCAAATCATCGTCGCATTCGACCCAAGGAATTAAACTAA
TTTTTGCGTTTGAATTGTTTAAATTTTCACAAAGTCTTCGCTATGAGTAC
TATTGGCACTGGATACGACTTGTCGGCCTCGCAGTTTTCGCCTGATGGCC
GCGTTTTCCAGATCGACTACGCCTCAAAGGCGGTGGAGAAGAGCGGCACC
GTAATCGGGATTCGGGGCAAGGACGCCGTGGTGCTGGCCGTGGAGAAGAT
CATCACCAGTAAACTGTACGAACCAGACGCCGGCGGACGCATCTTCACCA
TCGAAAAGAACATCGGAATGGCGGTGGCCGGCTTGGTGGCCGATGGAAAC
TTTGTGGCTGACATTGCGCGTCAGGAGGCAGCCAACTACAGACAGCAATT
TGAGCAGGCTATCCCGCTTAAACACCTGTGCCACCGAGTCGCCGGCTACG
TTCACGCCTACACTCTGTACAGTGCCGTCCGCCCCTTCGGACTTTCCATC
ATTCTCGCCTCCTTCGGTTACTTCGCCTGCGCCAGCGGCAAGGCCAAGCA
GCTGGCCAAGACTGAGATGGAGAAGCTCAAGATGGATATGAGGACCGACG
AATTGGTGGAGAGCGCTGGTGAAATCATCTACAAAGTCCATGACGAGTTG
AAGGACAAGGACTTCCGCTTCGAAATGGGTTTGGTGGGCAGGGTAACCGG
TGGCCTACATCTCATAAATCCCTCAGAACTGACGGAGAAGGCGAGGAAAG
CCGGCGATGCGGCCAACAAGGACGAAGACAGCGACAATGAGACGCACTAG
TTCGTTTGTGTGCCAGTGAATCTAATTCTGGGCCTCATACATAATGTTAA
TTTTATATTTCCCTAAAGCGCAAAATGAATAAACAAAATCGGGTGAAAAA
AAAAAAAAAAAAA

AT17601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 1037 Prosalpha7-RA 51..563 1..513 2565 100 Plus
Prosalpha7.a 967 Prosalpha7.a 26..538 1..513 2565 100 Plus
Prosalpha7-RA 1037 Prosalpha7-RA 612..1002 508..898 1955 100 Plus
Prosalpha7.a 967 Prosalpha7.a 701..966 633..898 1315 99.6 Plus
Prosalpha7.a 967 Prosalpha7.a 587..704 508..625 590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5734718..5735117 513..114 2000 100 Minus
chr2R 21145070 chr2R 5734115..5734384 895..626 1350 100 Minus
chr2R 21145070 chr2R 5734552..5734669 625..508 590 100 Minus
chr2R 21145070 chr2R 5735176..5735288 113..1 565 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:51:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9847239..9847638 513..114 2000 100 Minus
2R 25286936 2R 9846633..9846905 898..626 1365 100 Minus
2R 25286936 2R 9847073..9847190 625..508 590 100 Minus
2R 25286936 2R 9847697..9847809 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9848438..9848837 513..114 2000 100 Minus
2R 25260384 2R 9847832..9848104 898..626 1365 100 Minus
2R 25260384 2R 9848272..9848389 625..508 590 100 Minus
2R 25260384 2R 9848896..9849008 113..1 565 100 Minus
Blast to na_te.dros performed 2019-03-16 19:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1817..1864 548..597 136 80 Plus

AT17601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:05:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5735176..5735288 1..113 100   Minus
chr2R 5734115..5734384 626..895 100 <- Minus
chr2R 5734552..5734671 507..625 98 <- Minus
chr2R 5734725..5735117 114..506 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:10:53 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RB 1..708 93..800 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:14 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..419 93..511 100 <- Plus
Prosalpha7-RA 474..762 512..800 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:53 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..419 93..511 100 <- Plus
Prosalpha7-RA 474..762 512..800 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:05 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RB 1..708 93..800 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..419 93..511 100 <- Plus
Prosalpha7-RA 474..762 512..800 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:17 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RB 26..920 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:14 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 26..536 1..511 100 <- Plus
Prosalpha7-RA 591..974 512..895 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:53 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 28..538 1..511 100 <- Plus
Prosalpha7-RA 593..976 512..895 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:05 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RB 26..920 1..895 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 593..976 512..895 100   Plus
Prosalpha7-RA 28..538 1..511 100 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847073..9847192 507..625 98 <- Minus
2R 9846636..9846905 626..895 100 <- Minus
2R 9847246..9847638 114..506 100 <- Minus
2R 9847697..9847809 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847073..9847192 507..625 98 <- Minus
2R 9846636..9846905 626..895 100 <- Minus
2R 9847246..9847638 114..506 100 <- Minus
2R 9847697..9847809 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:51 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847073..9847192 507..625 98 <- Minus
2R 9846636..9846905 626..895 100 <- Minus
2R 9847246..9847638 114..506 100 <- Minus
2R 9847697..9847809 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:53 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5734578..5734697 507..625 98 <- Minus
arm_2R 5734141..5734410 626..895 100 <- Minus
arm_2R 5734751..5735143 114..506 100 <- Minus
arm_2R 5735202..5735314 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:21 Download gff for AT17601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847835..9848104 626..895 100 <- Minus
2R 9848272..9848391 507..625 98 <- Minus
2R 9848445..9848837 114..506 100 <- Minus
2R 9848896..9849008 1..113 100   Minus

AT17601.pep Sequence

Translation from 92 to 799

> AT17601.pep
MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAV
EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR
QQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASFGYFACASGK
AKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVGR
VTGGLHLINPSELTEKARKAGDAANKDEDSDNETH*

AT17601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13142-PA 253 GF13142-PA 1..253 1..235 1055 80.2 Plus
Dana\GF14761-PA 253 GF14761-PA 1..253 1..235 974 71.9 Plus
Dana\GF11235-PA 244 GF11235-PA 8..242 7..222 263 28.4 Plus
Dana\GF11246-PA 252 GF11246-PA 5..138 8..141 252 36.6 Plus
Dana\GF19028-PA 249 GF19028-PA 1..138 4..141 241 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25255-PA 253 GG25255-PA 1..252 1..234 1112 86.1 Plus
Dere\GG10705-PA 244 GG10705-PA 8..242 7..222 253 28.2 Plus
Dere\GG15180-PA 251 GG15180-PA 1..190 4..178 248 30.6 Plus
Dere\GG17945-PA 249 GG17945-PA 1..138 4..141 240 34.8 Plus
Dere\GG18927-PA 234 GG18927-PA 6..191 8..175 230 32.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21325-PA 253 GH21325-PA 1..252 1..233 963 73.4 Plus
Dgri\GH20588-PA 244 GH20588-PA 8..242 7..222 247 27.3 Plus
Dgri\GH12557-PA 249 GH12557-PA 1..138 4..141 239 34.8 Plus
Dgri\GH13898-PA 234 GH13898-PA 6..191 8..175 235 32.3 Plus
Dgri\GH20521-PA 263 GH20521-PA 5..183 8..190 226 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..253 1..235 1163 92.9 Plus
Prosalpha1-PB 244 CG18495-PB 8..242 7..222 255 28.4 Plus
Prosalpha1-PA 244 CG18495-PA 8..242 7..222 255 28.4 Plus
CG30382-PB 244 CG30382-PB 8..242 7..222 255 28.4 Plus
CG30382-PA 244 CG30382-PA 8..242 7..222 255 28.4 Plus
Prosalpha4-PA 249 CG3422-PA 5..181 8..194 239 32.6 Plus
Prosalpha4T1-PA 249 CG17268-PA 5..135 8..138 225 33.6 Plus
Prosalpha2-PA 234 CG5266-PA 6..191 8..175 221 32.3 Plus
Prosalpha4T2-PB 252 CG4569-PB 5..187 8..177 219 29.8 Plus
Prosalpha4T2-PA 252 CG4569-PA 5..187 8..177 219 29.8 Plus
Prosalpha3-PA 264 CG9327-PA 5..135 8..137 215 33.6 Plus
Prosalpha3T-PA 251 CG1736-PA 5..134 8..137 212 33.8 Plus
Prosalpha5-PB 244 CG10938-PB 8..210 8..185 207 29.6 Plus
Prosalpha5-PA 244 CG10938-PA 8..210 8..185 207 29.6 Plus
Prosalpha6-PA 279 CG4904-PA 6..188 8..172 193 27 Plus
Prosalpha6-PB 279 CG4904-PB 6..188 8..172 193 27 Plus
Prosalpha6T-PA 289 CG5648-PA 6..137 8..141 189 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20743-PA 253 GI20743-PA 1..252 1..233 981 75 Plus
Dmoj\GI19734-PA 244 GI19734-PA 8..242 7..222 243 27.2 Plus
Dmoj\GI16051-PA 247 GI16051-PA 13..233 15..216 242 30.9 Plus
Dmoj\GI11210-PA 249 GI11210-PA 1..138 4..141 238 34.8 Plus
Dmoj\GI24829-PA 234 GI24829-PA 6..191 8..175 236 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10238-PA 254 GL10238-PA 1..254 1..235 1004 77.2 Plus
Dper\GL14346-PA 265 GL14346-PA 7..263 8..235 353 34.2 Plus
Dper\GL17442-PA 244 GL17442-PA 8..242 7..222 255 28.2 Plus
Dper\GL20413-PA 252 GL20413-PA 5..138 8..141 238 32.8 Plus
Dper\GL22394-PA 246 GL22394-PA 5..245 8..223 237 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24133-PA 254 GA24133-PA 1..254 1..235 1004 77.2 Plus
Dpse\GA25966-PA 197 GA25966-PA 5..197 5..178 432 43 Plus
Dpse\GA22984-PA 265 GA22984-PA 7..263 8..235 347 33.9 Plus
Dpse\GA15805-PA 244 GA15805-PA 8..242 7..222 255 28.2 Plus
Dpse\GA17441-PA 249 GA17441-PA 1..138 4..141 241 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24383-PA 253 GM24383-PA 1..253 1..235 1190 91.3 Plus
Dsec\GM20573-PA 181 GM20573-PA 1..179 1..163 505 62.4 Plus
Dsec\GM20751-PA 244 GM20751-PA 8..242 7..222 251 28.4 Plus
Dsec\Pros28.1A-PA 251 GM23164-PA 1..135 4..138 234 32.6 Plus
Dsec\GM24033-PA 234 GM24033-PA 6..191 8..175 229 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10046-PA 253 GD10046-PA 1..253 1..235 1190 91.3 Plus
Dsim\GD10216-PA 244 GD10216-PA 8..242 7..222 251 28.4 Plus
Dsim\Pros28.1A-PA 251 GD20037-PA 1..135 4..138 244 33.3 Plus
Dsim\GD18834-PA 234 GD18834-PA 6..191 8..175 229 32.3 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 5..176 8..161 227 29.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20480-PA 252 GJ20480-PA 1..251 1..233 930 73 Plus
Dvir\GJ18434-PA 244 GJ18434-PA 8..242 7..222 250 27.6 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 1..138 4..141 239 34.8 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 6..191 8..175 234 31.7 Plus
Dvir\GJ21990-PA 263 GJ21990-PA 5..183 8..190 225 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20963-PA 256 GK20963-PA 1..253 1..233 932 72.3 Plus
Dwil\GK21354-PA 244 GK21354-PA 8..242 7..222 248 26.7 Plus
Dwil\GK19681-PA 255 GK19681-PA 1..176 4..161 240 30.1 Plus
Dwil\GK14404-PA 234 GK14404-PA 6..191 8..175 239 32.8 Plus
Dwil\GK25669-PA 249 GK25669-PA 5..138 8..141 235 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21995-PA 253 GE21995-PA 1..252 1..234 1125 86.9 Plus
Dyak\GE23574-PA 244 GE23574-PA 8..242 7..222 258 28.6 Plus
Dyak\GE25043-PA 251 GE25043-PA 1..190 4..178 249 30.6 Plus
Dyak\GE17253-PA 249 GE17253-PA 1..138 4..141 240 34.8 Plus
Dyak\GE26194-PA 234 GE26194-PA 6..191 8..175 235 32.8 Plus

AT17601.hyp Sequence

Translation from 92 to 564

> AT17601.hyp
MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAV
EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR
QQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILLLLRLLRLRQRQ
GQAAGQD*

AT17601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..138 1..138 694 100 Plus
Prosalpha1-PB 244 CG18495-PB 8..141 7..139 241 35.8 Plus
Prosalpha1-PA 244 CG18495-PA 8..141 7..139 241 35.8 Plus
CG30382-PB 244 CG30382-PB 8..141 7..139 241 35.8 Plus
CG30382-PA 244 CG30382-PA 8..141 7..139 241 35.8 Plus