Clone AT17982 Report

Search the DGRC for AT17982

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:179
Well:82
Vector:pOTB7
Associated Gene/TranscriptCG42523-RA
Protein status:AT17982.pep: gold
Sequenced Size:619

Clone Sequence Records

AT17982.complete Sequence

619 bp (619 high quality bases) assembled on 2004-05-03

GenBank Submission: BT014670

> AT17982.complete
CAGACATTAGTTGAAAATTTCTAAATTAATTTTTTTTCATCAATATGAAC
TTCAAGGCTCGTTATTCGAAATCTGTAAGTCCACCGAAGCGAGTAGGAAT
ATCCCTCGAGGATCCTGTGTCCAGCTGCGATGAGTTTCCCAGACCCCTGG
GTCCGATGTTGAAATACATAGCCCTGTCTCCGAATTATCAGATGCCCAGG
AGAAAAGCTCCTCTAAATAGGGCCAATGTGCCAAAAACAAACCGGGCCAG
AAAATCTGGAAAAAAACACAAGATGCACTTATCCAAGGCATCGACTTACG
GCCGAAAGCGCCCTGCCAGAAAAGTCACAAAAAGGCGAGATGTGATCAAC
AAGAAACCCAGAAAATCGAAAGGCACCAAGATCATTGGTGGGGAGGAGAA
GCCCATAGAATCCAATAGTAGACCCTGGTGGAAATTGTTGTTTAGCAGAA
AGCAGAATGACGAAAAAACACAGCAAGATAACATATCCTGCAATGTTTTG
ATGACCGACAGGTCAACCCAAACGATTGTCAGTCCTCAATGTAATAATAT
TGATGACGATAAACTTGCACCATTTGACAAGCCAAATAAATACATTTAGC
TAAAAAAAAAAAAAAAAAA

AT17982.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG42523-RA 601 CG42523-RA 1..601 1..601 3005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4762065..4762665 1..601 3005 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4762937..4763540 1..604 3020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4762937..4763540 1..604 3020 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:14:52 has no hits.

AT17982.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:15:45 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4762065..4762665 1..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:59 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 1..555 45..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:08:56 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 1..555 45..599 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 21:29:06 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:50 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 1..555 45..599 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:59 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 1..601 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:08:56 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 43..643 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 21:29:09 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:50 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42523-RA 43..643 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:45 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4762937..4763537 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:45 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4762937..4763537 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:45 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4762937..4763537 1..601 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:08:56 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4762937..4763537 1..601 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:06:15 Download gff for AT17982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4762937..4763537 1..601 100   Plus

AT17982.hyp Sequence

Translation from 44 to 598

> AT17982.hyp
MNFKARYSKSVSPPKRVGISLEDPVSSCDEFPRPLGPMLKYIALSPNYQM
PRRKAPLNRANVPKTNRARKSGKKHKMHLSKASTYGRKRPARKVTKRRDV
INKKPRKSKGTKIIGGEEKPIESNSRPWWKLLFSRKQNDEKTQQDNISCN
VLMTDRSTQTIVSPQCNNIDDDKLAPFDKPNKYI*

AT17982.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42523-PB 184 CG42523-PB 1..184 1..184 975 100 Plus
CG42523-PA 184 CG42523-PA 1..184 1..184 975 100 Plus

AT17982.pep Sequence

Translation from 44 to 598

> AT17982.pep
MNFKARYSKSVSPPKRVGISLEDPVSSCDEFPRPLGPMLKYIALSPNYQM
PRRKAPLNRANVPKTNRARKSGKKHKMHLSKASTYGRKRPARKVTKRRDV
INKKPRKSKGTKIIGGEEKPIESNSRPWWKLLFSRKQNDEKTQQDNISCN
VLMTDRSTQTIVSPQCNNIDDDKLAPFDKPNKYI*

AT17982.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42523-PB 184 CG42523-PB 1..184 1..184 975 100 Plus
CG42523-PA 184 CG42523-PA 1..184 1..184 975 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23298-PA 180 GD23298-PA 1..176 1..170 613 74 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18305-PA 175 GE18305-PA 1..163 1..163 446 57.2 Plus