BDGP Sequence Production Resources |
Search the DGRC for AT18054
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 180 |
Well: | 54 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG17580-RA |
Protein status: | AT18054.pep: gold |
Preliminary Size: | 222 |
Sequenced Size: | 1058 |
Gene | Date | Evidence |
---|---|---|
CG17580 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17580 | 2002-05-31 | Blastp of sequenced clone |
CG17580 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17580 | 2008-04-29 | Release 5.5 accounting |
CG17580 | 2008-08-15 | Release 5.9 accounting |
CG17580 | 2008-12-18 | 5.12 accounting |
1058 bp (1058 high quality bases) assembled on 2002-05-31
GenBank Submission: AY118288
> AT18054.complete GAAAGTTAAAGGCCCAGGGAAATGGGAAACAAGCTGCGCCGCCAACCACA AAGAGTTGAAGTTGACGAGGAGGAGGTGAGATCCGACCGACCCCAGAAGA AGCCACCATCGTCATGGCCCTTCTGGCGCCTGGTCTACTGGCTGGGAGTC CTCATCATGGTCATCGGCATCGGTGTGGGCATGTACTTCACCCTCAAGTC GGACTTCGGTGAGTGCTCCTCCTACGACGTCCGTTGCGATTGAGTGCTCC TGGCGATATAGAAACTTCCACGGAAATGGCGGAATTCATTACCCATTGAA CTTCAACTAATTTGAAGCAGCTTGGCCTGCGAAAGCAATTGTTCTACATT TAGCGAGAATTTAATTAAAACTTATACACCAGTTATGTTTTCTTGTCGAA ACATCAGTTTGATCTTTTTACTTTTTATCATCGCAGTCTACATTTGCCTG TTTGTTTTATATATACTCCACAGAGTTGGTGAAGATAATTAATATTGGAT TCATATGTAAAGTTATTCATTTGTCTGTTCTCCTGTTTGAATTGTGATAT GCTAAGCTTGGTTATATCACTATCAACTTACGTGCAGTCCAATACTTGTC ATACATGAATTCTAGCAGCTGGATCTTAATTAAAGCCGGATGAAACAACC CACCCCACACTAGACCGCCTCCTTTATTGTTAACAATTACAAAAGCAAGG CCGAAGCCGCGCAATCTCCAGCAACACATGCAGATACATTTGTGCATGTA GACGTGTGTATTTGTGATGCTATTCAAACTTATTGGAGCGCTTCCTTTTG ATGGCGTTCTGGTTGACTCTTCAATGGCGAAACACTTTTTAGTTGAATGA AGCTAGTGAATGCACATATTTTGGGTTGCATATAAAAAATCCTACGATTA TTCACTGGCCCTATTTATTTTGGTGTTAATTAACGAAGTGGAGAATGGCA TTCATTGATAAAAGTGTACAACGATTTTTATTTCACATACAAAATGACTG CATGTGTATACTATTGCTGTAATTAAAATATCAATTTGAAAAAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17580-RA | 1086 | CG17580-RA | 64..1052 | 1..989 | 4945 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8694545..8695085 | 498..1038 | 2675 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 8693936..8694293 | 1..358 | 1790 | 100 | Plus |
chr2R | 21145070 | chr2R | 8694349..8694488 | 359..498 | 700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12807286..12807777 | 498..989 | 2460 | 100 | Plus |
2R | 25286936 | 2R | 12806677..12807034 | 1..358 | 1790 | 100 | Plus |
2R | 25286936 | 2R | 12807090..12807229 | 359..498 | 700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12808485..12808976 | 498..989 | 2460 | 100 | Plus |
2R | 25260384 | 2R | 12807876..12808233 | 1..358 | 1790 | 100 | Plus |
2R | 25260384 | 2R | 12808289..12808428 | 359..498 | 700 | 100 | Plus |
2R | 25260384 | 2R | 12808979..12809012 | 1007..1040 | 140 | 94.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8693936..8694293 | 1..358 | 100 | -> | Plus |
chr2R | 8694349..8694488 | 359..498 | 100 | -> | Plus |
chr2R | 8694546..8695085 | 499..1038 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..222 | 22..243 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..222 | 22..243 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..222 | 22..243 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..222 | 22..243 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..222 | 22..243 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..989 | 1..989 | 100 | == | Plus |
CG17580-RA | 996..1023 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..989 | 1..989 | 100 | == | Plus |
CG17580-RA | 996..1023 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 64..1052 | 1..989 | 100 | == | Plus |
CG17580-RA | 1059..1086 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 1..989 | 1..989 | 100 | == | Plus |
CG17580-RA | 996..1023 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17580-RA | 64..1052 | 1..989 | 100 | == | Plus |
CG17580-RA | 1059..1086 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12806677..12807034 | 1..358 | 100 | -> | Plus |
2R | 12807090..12807229 | 359..498 | 100 | -> | Plus |
2R | 12807287..12807777 | 499..989 | 100 | == | Plus |
2R | 12807784..12807811 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12806677..12807034 | 1..358 | 100 | -> | Plus |
2R | 12807090..12807229 | 359..498 | 100 | -> | Plus |
2R | 12807287..12807777 | 499..989 | 100 | == | Plus |
2R | 12807784..12807811 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12806677..12807034 | 1..358 | 100 | -> | Plus |
2R | 12807090..12807229 | 359..498 | 100 | -> | Plus |
2R | 12807287..12807777 | 499..989 | 100 | == | Plus |
2R | 12807784..12807811 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8694182..8694539 | 1..358 | 100 | -> | Plus |
arm_2R | 8694595..8694734 | 359..498 | 100 | -> | Plus |
arm_2R | 8694792..8695282 | 499..989 | 100 | == | Plus |
arm_2R | 8695289..8695316 | 1011..1038 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12807876..12808233 | 1..358 | 100 | -> | Plus |
2R | 12808289..12808428 | 359..498 | 100 | -> | Plus |
2R | 12808486..12808976 | 499..989 | 100 | == | Plus |
2R | 12808983..12809010 | 1011..1038 | 96 | Plus |
Translation from 21 to 242
> AT18054.pep MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI GVGMYFTLKSDFGECSSYDVRCD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12921-PA | 170 | GF12921-PA | 26..85 | 12..69 | 191 | 63.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20338-PA | 72 | GG20338-PA | 1..72 | 1..73 | 336 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17580-PA | 73 | CG17580-PA | 1..73 | 1..73 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19310-PA | 64 | GI19310-PA | 1..63 | 1..72 | 129 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15856-PA | 70 | GL15856-PA | 1..70 | 1..73 | 184 | 42.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23512-PA | 70 | GA23512-PA | 20..70 | 23..73 | 167 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21426-PA | 72 | GM21426-PA | 1..72 | 1..73 | 355 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10922-PA | 72 | GD10922-PA | 1..72 | 1..73 | 355 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22188-PA | 67 | GJ22188-PA | 1..66 | 1..72 | 131 | 36.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15587-PA | 73 | GK15587-PA | 2..73 | 1..73 | 160 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12497-PA | 72 | GE12497-PA | 1..72 | 1..73 | 342 | 90.4 | Plus |
Translation from 21 to 242
> AT18054.hyp MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI GVGMYFTLKSDFGECSSYDVRCD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17580-PA | 73 | CG17580-PA | 1..73 | 1..73 | 400 | 100 | Plus |