Clone AT18054 Report

Search the DGRC for AT18054

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:180
Well:54
Vector:pOTB7
Associated Gene/TranscriptCG17580-RA
Protein status:AT18054.pep: gold
Preliminary Size:222
Sequenced Size:1058

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17580 2002-01-01 Sim4 clustering to Release 2
CG17580 2002-05-31 Blastp of sequenced clone
CG17580 2003-01-01 Sim4 clustering to Release 3
CG17580 2008-04-29 Release 5.5 accounting
CG17580 2008-08-15 Release 5.9 accounting
CG17580 2008-12-18 5.12 accounting

Clone Sequence Records

AT18054.complete Sequence

1058 bp (1058 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118288

> AT18054.complete
GAAAGTTAAAGGCCCAGGGAAATGGGAAACAAGCTGCGCCGCCAACCACA
AAGAGTTGAAGTTGACGAGGAGGAGGTGAGATCCGACCGACCCCAGAAGA
AGCCACCATCGTCATGGCCCTTCTGGCGCCTGGTCTACTGGCTGGGAGTC
CTCATCATGGTCATCGGCATCGGTGTGGGCATGTACTTCACCCTCAAGTC
GGACTTCGGTGAGTGCTCCTCCTACGACGTCCGTTGCGATTGAGTGCTCC
TGGCGATATAGAAACTTCCACGGAAATGGCGGAATTCATTACCCATTGAA
CTTCAACTAATTTGAAGCAGCTTGGCCTGCGAAAGCAATTGTTCTACATT
TAGCGAGAATTTAATTAAAACTTATACACCAGTTATGTTTTCTTGTCGAA
ACATCAGTTTGATCTTTTTACTTTTTATCATCGCAGTCTACATTTGCCTG
TTTGTTTTATATATACTCCACAGAGTTGGTGAAGATAATTAATATTGGAT
TCATATGTAAAGTTATTCATTTGTCTGTTCTCCTGTTTGAATTGTGATAT
GCTAAGCTTGGTTATATCACTATCAACTTACGTGCAGTCCAATACTTGTC
ATACATGAATTCTAGCAGCTGGATCTTAATTAAAGCCGGATGAAACAACC
CACCCCACACTAGACCGCCTCCTTTATTGTTAACAATTACAAAAGCAAGG
CCGAAGCCGCGCAATCTCCAGCAACACATGCAGATACATTTGTGCATGTA
GACGTGTGTATTTGTGATGCTATTCAAACTTATTGGAGCGCTTCCTTTTG
ATGGCGTTCTGGTTGACTCTTCAATGGCGAAACACTTTTTAGTTGAATGA
AGCTAGTGAATGCACATATTTTGGGTTGCATATAAAAAATCCTACGATTA
TTCACTGGCCCTATTTATTTTGGTGTTAATTAACGAAGTGGAGAATGGCA
TTCATTGATAAAAGTGTACAACGATTTTTATTTCACATACAAAATGACTG
CATGTGTATACTATTGCTGTAATTAAAATATCAATTTGAAAAAAAAAAAA
AAAAAAAA

AT18054.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-RA 1086 CG17580-RA 64..1052 1..989 4945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8694545..8695085 498..1038 2675 99.6 Plus
chr2R 21145070 chr2R 8693936..8694293 1..358 1790 100 Plus
chr2R 21145070 chr2R 8694349..8694488 359..498 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12807286..12807777 498..989 2460 100 Plus
2R 25286936 2R 12806677..12807034 1..358 1790 100 Plus
2R 25286936 2R 12807090..12807229 359..498 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12808485..12808976 498..989 2460 100 Plus
2R 25260384 2R 12807876..12808233 1..358 1790 100 Plus
2R 25260384 2R 12808289..12808428 359..498 700 100 Plus
2R 25260384 2R 12808979..12809012 1007..1040 140 94.1 Plus
Blast to na_te.dros performed on 2019-03-15 23:19:46 has no hits.

AT18054.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:20:45 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8693936..8694293 1..358 100 -> Plus
chr2R 8694349..8694488 359..498 100 -> Plus
chr2R 8694546..8695085 499..1038 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:11:38 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..222 22..243 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:32 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..222 22..243 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:06 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..222 22..243 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:26:08 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..222 22..243 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:29:20 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..222 22..243 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:46 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..989 1..989 100 == Plus
CG17580-RA 996..1023 1011..1038 96   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:32 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..989 1..989 100 == Plus
CG17580-RA 996..1023 1011..1038 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:06 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 64..1052 1..989 100 == Plus
CG17580-RA 1059..1086 1011..1038 96   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:08 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 1..989 1..989 100 == Plus
CG17580-RA 996..1023 1011..1038 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:29:20 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 64..1052 1..989 100 == Plus
CG17580-RA 1059..1086 1011..1038 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:45 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12806677..12807034 1..358 100 -> Plus
2R 12807090..12807229 359..498 100 -> Plus
2R 12807287..12807777 499..989 100 == Plus
2R 12807784..12807811 1011..1038 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:45 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12806677..12807034 1..358 100 -> Plus
2R 12807090..12807229 359..498 100 -> Plus
2R 12807287..12807777 499..989 100 == Plus
2R 12807784..12807811 1011..1038 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:45 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12806677..12807034 1..358 100 -> Plus
2R 12807090..12807229 359..498 100 -> Plus
2R 12807287..12807777 499..989 100 == Plus
2R 12807784..12807811 1011..1038 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:06 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8694182..8694539 1..358 100 -> Plus
arm_2R 8694595..8694734 359..498 100 -> Plus
arm_2R 8694792..8695282 499..989 100 == Plus
arm_2R 8695289..8695316 1011..1038 96   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:34 Download gff for AT18054.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12807876..12808233 1..358 100 -> Plus
2R 12808289..12808428 359..498 100 -> Plus
2R 12808486..12808976 499..989 100 == Plus
2R 12808983..12809010 1011..1038 96   Plus

AT18054.pep Sequence

Translation from 21 to 242

> AT18054.pep
MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI
GVGMYFTLKSDFGECSSYDVRCD*

AT18054.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12921-PA 170 GF12921-PA 26..85 12..69 191 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20338-PA 72 GG20338-PA 1..72 1..73 336 89 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-PA 73 CG17580-PA 1..73 1..73 400 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19310-PA 64 GI19310-PA 1..63 1..72 129 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15856-PA 70 GL15856-PA 1..70 1..73 184 42.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23512-PA 70 GA23512-PA 20..70 23..73 167 54.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21426-PA 72 GM21426-PA 1..72 1..73 355 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10922-PA 72 GD10922-PA 1..72 1..73 355 93.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22188-PA 67 GJ22188-PA 1..66 1..72 131 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15587-PA 73 GK15587-PA 2..73 1..73 160 44 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12497-PA 72 GE12497-PA 1..72 1..73 342 90.4 Plus

AT18054.hyp Sequence

Translation from 21 to 242

> AT18054.hyp
MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI
GVGMYFTLKSDFGECSSYDVRCD*

AT18054.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-PA 73 CG17580-PA 1..73 1..73 400 100 Plus