Clone AT18160 Report

Search the DGRC for AT18160

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:181
Well:60
Vector:pOTB7
Associated Gene/TranscriptCG9945-RA
Protein status:AT18160.pep: gold
Preliminary Size:1563
Sequenced Size:1949

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9945 2002-01-01 Sim4 clustering to Release 2
CG9945 2002-01-03 Blastp of sequenced clone
CG9945 2003-01-01 Sim4 clustering to Release 3
CG9945 2008-04-29 Release 5.5 accounting
CG9945 2008-08-15 Release 5.9 accounting
CG9945 2008-12-18 5.12 accounting

Clone Sequence Records

AT18160.complete Sequence

1949 bp (1949 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075228

> AT18160.complete
TTTATATAAATATTTATATAGAAAGGTTTTACAATTTTTTGTTCGTAATC
TGCTGCGATAGATCGATAGGTGTTCAACGTTTGAACTTGAACATCGTGGT
ATTTTCAGGCTCTTCACCTGCGGTCTCACTGGCTGCAACAATTATCGAAG
AAACGATAGGTTGAAATTAATAACAAAAGAGTGCAAAAGGGAAAACGCAA
AAAGTTATGGGGAACCAATTGGCTATACAGATGAATAGCGATGAAGACGA
CGATTTTGATTCTTCGGACAACGAGCTGGGCTTCAACGTGATCAACTTTA
CGGTGAACGCCATGGATCTGCGCTCCGATTATTGCAGCAGCGAGATGCCA
GTTATACGAGGCAAGCCCGATCTAGTTAAATTTCAGAAAACTGATATGTA
CAAGGAGATCCAGGCGTCGAGTGGATTAGTGAGCAATCCGAACAATCGCT
GGAACCTGGTGCACGCCCTTCAGCAGCGTGAGAATGGGTTGGCATCGCCG
CACAGCGCATCGTTCTCCAAGAACCAGCAGCGCTACATATCCAATCTTTA
CATACCAAACAAAAAGGCCACACGCCTGATGTCGCTGGAATCCAAAATAT
TTGTGACCAAGTTCAATCGTTCGGGCAGCAAGTTGCTGACCGCTTGTCAA
GATGGCTTTGTGCGCATTTACGATGGCGCCAAGGGCACTTATCACCTGCT
GAATCGCATCCGAGCCCGCGATGTTGAGTGGAGCATCATCGATGCGGATT
TTAGTCCGAATGGCGAGCACTTCGCCTACAGCACCTGGTCCCGCTCATTG
TTCATCATGCCCGTGAATGGGGGGGAAGACGACTGCCAGTGGATCGATGT
CAATGGACTGCCAAGCCATAGGTTGGCCATCTTCTCGCTGCGCTATTCGC
CAACAGGCGACAAAATCATCGGGGGCAGCAACAATTCCACGGTCATCGTG
ACCGACATTCGCACAAGAAACACACAGATCCTGCGCACCCACCGCATGCC
CGGCAAGGATGTTAACTCGGTGTGCTTCCTACACGATAAGGATCCAAATG
TGATAATCGCCGGCTGTGACGACGGCCTGCTAAAGGTCTACGACCTGCGC
ACCACCTTCCGTTCACGGGACCTGTCCAAGTCTGTGGCATCCTTCATCGG
CCACTACGATGGCATCACCTACATCGATTCGCGCAACGACGGCTACCACG
TGCTGTCCAACTCCAAAGACCAAAGCATCAAAATCTGGGACATAAGGCAG
CCGAGCAATATGCGTAATCGCAGTCGTTCTAGACAGCAAGTCGACCCCAC
CACATGGGACTACCGATGGAACCGCGTTCCGCGGGAATTTTACAATCCGC
ATAAGCCACTGGAAGGAGACTCCAGCATAATGACCTACCGCGGTCACCGA
GTTACCAAAACCCTGTTGCGGGCGAAGTTCTCACCCATGGAGCAGACAGG
GCAACGCTACATTTACACAGGCTGTGCCACCGGACGTATTATAATTTATG
ATGTACTTACTGGTAAGATTCAAGAGGCTATTGAAGGACATAGGACTGTG
ATAAGAGATCTGGACTGGCATCCGGATCGCTCAGAAATCGTGTCTGGCTC
GTGGGACACCCATGTTCACCTGAACAACTTCAGCCGCAGCAACGCCAATC
GTCCGGTAAAGCGATCACATAGCTCGGATCATGACAAAAAGCCCCTGAGA
AGATCACGCCGTTTGGCGAATCGCAATGTAACACCGGACTAGTTTGGCTT
GCCTAAGCGACGCACGAGAATATTCACCACAGTCGGGCCGGCTGGGATAA
TTGGTTCTATTAAATAAGACTGAAGAATATGTCACTCACTTGAAATGTAT
AGTTCAGTTTAATTAGTTAGCGTGTTATACAAAACAGTACATTAAAATGT
AAACCATGAAGCTTACCAACTACCTAAAAAAAAAAAAAAAAAAAAAAAA

AT18160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9945-RA 2029 CG9945-RA 1..1926 1..1926 9585 99.8 Plus
CG9945-RB 2095 CG9945-RB 1..1744 1..1744 8675 99.8 Plus
CG9945-RB 2095 CG9945-RB 1811..1992 1745..1926 910 100 Plus
CG11180.a 2335 CG11180.a 2233..2335 1926..1824 515 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16506199..16506742 795..1338 2705 99.8 Plus
chr2R 21145070 chr2R 16505226..16505611 1..386 1930 100 Plus
chr2R 21145070 chr2R 16505676..16505943 384..651 1340 100 Plus
chr2R 21145070 chr2R 16507540..16507720 1745..1925 905 100 Plus
chr2R 21145070 chr2R 16506803..16506958 1339..1494 780 100 Plus
chr2R 21145070 chr2R 16506002..16506150 650..798 745 100 Plus
chr2R 21145070 chr2R 16507330..16507473 1601..1744 720 100 Plus
chr2R 21145070 chr2R 16507161..16507267 1495..1601 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20619476..20620019 795..1338 2705 99.8 Plus
2R 25286936 2R 20618503..20618888 1..386 1930 100 Plus
2R 25286936 2R 20618953..20619220 384..651 1340 100 Plus
2R 25286936 2R 20620817..20620998 1745..1926 910 100 Plus
2R 25286936 2R 20620080..20620235 1339..1494 780 100 Plus
2R 25286936 2R 20619279..20619427 650..798 745 100 Plus
2R 25286936 2R 20620607..20620750 1601..1744 675 97.9 Plus
2R 25286936 2R 20620438..20620544 1495..1601 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20620675..20621218 795..1338 2705 99.8 Plus
2R 25260384 2R 20619702..20620087 1..386 1930 100 Plus
2R 25260384 2R 20620152..20620419 384..651 1340 100 Plus
2R 25260384 2R 20622016..20622197 1745..1926 910 100 Plus
2R 25260384 2R 20621279..20621434 1339..1494 780 100 Plus
2R 25260384 2R 20620478..20620626 650..798 745 100 Plus
2R 25260384 2R 20621806..20621949 1601..1744 675 97.9 Plus
2R 25260384 2R 20621637..20621743 1495..1601 535 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:59:45 has no hits.

AT18160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:00:54 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16506803..16506958 1339..1494 100 -> Plus
chr2R 16507161..16507267 1495..1601 100 -> Plus
chr2R 16507331..16507473 1602..1744 100 -> Plus
chr2R 16507540..16507720 1745..1925 100   Plus
chr2R 16505251..16505611 26..386 100 -> Plus
chr2R 16505679..16505943 387..651 100 -> Plus
chr2R 16506004..16506150 652..798 100 -> Plus
chr2R 16506203..16506742 799..1338 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:11:47 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1536 207..1742 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:37 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1536 207..1742 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:58 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RB 1..1536 207..1742 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:21 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1536 207..1742 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:21 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RB 1..1536 207..1742 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:17 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1925 1..1925 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:37 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1925 1..1925 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:58 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1925 1..1925 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:21 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1925 1..1925 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:21 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
CG9945-RA 1..1925 1..1925 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:00:54 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20618956..20619220 387..651 100 -> Plus
2R 20619281..20619427 652..798 100 -> Plus
2R 20618503..20618888 1..386 100 -> Plus
2R 20619480..20620019 799..1338 100 -> Plus
2R 20620080..20620235 1339..1494 100 -> Plus
2R 20620438..20620544 1495..1601 100 -> Plus
2R 20620608..20620750 1602..1744 97 -> Plus
2R 20620817..20620997 1745..1925 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:00:54 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20618956..20619220 387..651 100 -> Plus
2R 20619281..20619427 652..798 100 -> Plus
2R 20618503..20618888 1..386 100 -> Plus
2R 20619480..20620019 799..1338 100 -> Plus
2R 20620080..20620235 1339..1494 100 -> Plus
2R 20620438..20620544 1495..1601 100 -> Plus
2R 20620608..20620750 1602..1744 97 -> Plus
2R 20620817..20620997 1745..1925 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:00:54 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20618956..20619220 387..651 100 -> Plus
2R 20619281..20619427 652..798 100 -> Plus
2R 20618503..20618888 1..386 100 -> Plus
2R 20619480..20620019 799..1338 100 -> Plus
2R 20620080..20620235 1339..1494 100 -> Plus
2R 20620438..20620544 1495..1601 100 -> Plus
2R 20620608..20620750 1602..1744 97 -> Plus
2R 20620817..20620997 1745..1925 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:58 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16507585..16507740 1339..1494 100 -> Plus
arm_2R 16507943..16508049 1495..1601 100 -> Plus
arm_2R 16506008..16506393 1..386 100 -> Plus
arm_2R 16506461..16506725 387..651 100 -> Plus
arm_2R 16506786..16506932 652..798 100 -> Plus
arm_2R 16506985..16507524 799..1338 100 -> Plus
arm_2R 16508113..16508255 1602..1744 97 -> Plus
arm_2R 16508322..16508502 1745..1925 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:19 Download gff for AT18160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20622016..20622196 1745..1925 100   Plus
2R 20619702..20620087 1..386 100 -> Plus
2R 20620155..20620419 387..651 100 -> Plus
2R 20620480..20620626 652..798 100 -> Plus
2R 20620679..20621218 799..1338 100 -> Plus
2R 20621279..20621434 1339..1494 100 -> Plus
2R 20621637..20621743 1495..1601 100 -> Plus
2R 20621807..20621949 1602..1744 97 -> Plus

AT18160.pep Sequence

Translation from 206 to 1741

> AT18160.pep
MGNQLAIQMNSDEDDDFDSSDNELGFNVINFTVNAMDLRSDYCSSEMPVI
RGKPDLVKFQKTDMYKEIQASSGLVSNPNNRWNLVHALQQRENGLASPHS
ASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKFNRSGSKLLTACQDG
FVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFI
MPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTD
IRTRNTQILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTT
FRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPS
NMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVT
KTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIR
DLDWHPDRSEIVSGSWDTHVHLNNFSRSNANRPVKRSHSSDHDKKPLRRS
RRLANRNVTPD*

AT18160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12184-PA 510 GF12184-PA 1..510 1..511 2295 84.1 Plus
Dana\GF20700-PA 347 GF20700-PA 9..345 129..475 226 25.5 Plus
Dana\GF13988-PA 579 GF13988-PA 298..565 182..465 171 22.9 Plus
Dana\GF22217-PA 361 GF22217-PA 80..347 182..465 168 22.9 Plus
Dana\GF17851-PA 332 GF17851-PA 175..306 226..372 161 29.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22044-PA 514 GG22044-PA 1..514 1..511 2506 92.2 Plus
Dere\GG24701-PA 347 GG24701-PA 55..345 174..475 229 26.9 Plus
Dere\GG12938-PA 361 GG12938-PA 80..347 182..465 168 22.9 Plus
Dere\GG17291-PA 471 GG17291-PA 314..445 226..372 155 28.4 Plus
Dere\GG17291-PA 471 GG17291-PA 193..386 281..480 154 26.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21983-PA 512 GH21983-PA 1..512 1..511 2014 73.8 Plus
Dgri\GH24732-PA 259 GH24732-PA 51..230 245..465 381 39.8 Plus
Dgri\GH11537-PA 347 GH11537-PA 39..345 109..475 220 25.6 Plus
Dgri\GH24921-PA 357 GH24921-PA 76..343 182..465 164 22.7 Plus
Dgri\GH22558-PA 336 GH22558-PA 179..310 226..372 162 30 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9945-PA 511 CG9945-PA 1..511 1..511 2719 100 Plus
CG9945-PB 511 CG9945-PB 1..511 1..511 2719 100 Plus
CG3436-PC 347 CG3436-PC 9..342 129..472 225 26 Plus
CG3436-PA 347 CG3436-PA 9..342 129..472 225 26 Plus
wds-PB 361 CG17437-PB 80..347 182..465 174 22.9 Plus
wds-PA 361 CG17437-PA 80..347 182..465 174 22.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19685-PA 513 GI19685-PA 1..513 1..511 1986 72.1 Plus
Dmoj\GI17028-PA 347 GI17028-PA 6..345 78..475 223 24.8 Plus
Dmoj\GI21774-PA 358 GI21774-PA 77..344 182..465 168 23.1 Plus
Dmoj\GI23133-PA 339 GI23133-PA 182..313 226..372 161 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17035-PA 510 GL17035-PA 24..510 29..511 2042 79.3 Plus
Dper\GL18847-PA 347 GL18847-PA 39..345 109..475 219 24.5 Plus
Dper\GL13093-PA 356 GL13093-PA 75..342 182..465 166 22.7 Plus
Dper\GL27199-PA 344 GL27199-PA 187..318 226..372 151 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22143-PA 510 GA22143-PA 24..510 29..511 2046 79.7 Plus
Dpse\GA17451-PA 347 GA17451-PA 39..345 109..475 219 24.5 Plus
Dpse\GA10752-PA 812 GA10752-PA 71..421 55..465 172 21.5 Plus
Dpse\GA14510-PA 356 GA14510-PA 75..342 182..465 166 22.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22028-PA 512 GM22028-PA 1..512 1..511 2525 94.5 Plus
Dsec\GM16719-PA 347 GM16719-PA 55..345 174..475 223 26.6 Plus
Dsec\GM19230-PA 361 GM19230-PA 80..347 182..465 166 23.1 Plus
Dsec\GM23851-PA 332 GM23851-PA 175..306 226..372 157 29.1 Plus
Dsec\GM23851-PA 332 GM23851-PA 54..246 281..479 151 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11525-PA 512 GD11525-PA 1..512 1..511 2508 94 Plus
Dsim\GD23005-PA 347 GD23005-PA 55..345 174..475 223 26.6 Plus
Dsim\GD16610-PA 361 GD16610-PA 80..347 182..465 166 23.1 Plus
Dsim\GD18659-PA 332 GD18659-PA 175..306 226..372 155 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17235-PA 513 GJ17235-PA 1..513 1..511 2026 73.8 Plus
Dvir\GJ24581-PA 347 GJ24581-PA 39..345 109..475 217 25.3 Plus
Dvir\GJ16947-PA 358 GJ16947-PA 77..344 182..465 168 22.9 Plus
Dvir\GJ10433-PA 349 GJ10433-PA 192..317 226..362 158 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21482-PA 518 GK21482-PA 1..517 1..510 2057 75.1 Plus
Dwil\GK23911-PA 347 GK23911-PA 39..345 109..475 219 25.3 Plus
Dwil\GK19997-PA 358 GK19997-PA 77..344 182..465 168 23.1 Plus
Dwil\GK22499-PA 334 GK22499-PA 177..308 226..372 159 29.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12125-PA 514 GE12125-PA 1..514 1..511 2537 94.2 Plus
Dyak\GE16626-PA 347 GE16626-PA 55..345 174..475 227 26.9 Plus
Dyak\GE16263-PA 361 GE16263-PA 80..347 182..465 168 22.9 Plus
Dyak\GE26002-PA 332 GE26002-PA 175..306 226..372 156 29.3 Plus
Dyak\GE26002-PA 332 GE26002-PA 54..246 281..479 154 26.8 Plus

AT18160.hyp Sequence

Translation from 206 to 1741

> AT18160.hyp
MGNQLAIQMNSDEDDDFDSSDNELGFNVINFTVNAMDLRSDYCSSEMPVI
RGKPDLVKFQKTDMYKEIQASSGLVSNPNNRWNLVHALQQRENGLASPHS
ASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKFNRSGSKLLTACQDG
FVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFI
MPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTD
IRTRNTQILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTT
FRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPS
NMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVT
KTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIR
DLDWHPDRSEIVSGSWDTHVHLNNFSRSNANRPVKRSHSSDHDKKPLRRS
RRLANRNVTPD*

AT18160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG9945-PA 511 CG9945-PA 1..511 1..511 2719 100 Plus
CG9945-PB 511 CG9945-PB 1..511 1..511 2719 100 Plus
CG3436-PC 347 CG3436-PC 9..342 129..472 225 26 Plus
CG3436-PA 347 CG3436-PA 9..342 129..472 225 26 Plus
wds-PB 361 CG17437-PB 80..347 182..465 174 22.9 Plus