Clone AT18239 Report

Search the DGRC for AT18239

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:182
Well:39
Vector:pOTB7
Associated Gene/TranscriptRpn12R-RA
Protein status:AT18239.pep: gold
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11552 2002-01-01 Sim4 clustering to Release 2
CG11552 2008-04-29 Release 5.5 accounting
CG11552 2008-08-15 Release 5.9 accounting
CG11552 2008-12-18 5.12 accounting

Clone Sequence Records

AT18239.complete Sequence

959 bp (959 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075229

> AT18239.complete
GTCAATCAAAACGAACAAAATTTTCATTCCCAAAAATTTAGTCGTTGTCG
AGACTTTGCTGTAATCATGTCGAATCTGTACACCGAATTGAAGAACGAGT
GGAGCAAACATGCGCCCAACCTCACCCACTGCTCCCGCCTCCTGGATGGC
TTCAAACTGGAGCTGGTGAGGTCCAACTTTGGAACAATCCAAACTGCATC
GAGTTCCAAGCAAAAGGATCAGCTAATCAAATCGCGGGAGATGCTGGAAA
TCGCCGTGGAACATAGCATCACCATCAAGGATTATGCTGCCTTCGAGAGA
TATATGGCCCAGTTGAATACCTACTACTATGATTACGATAAGTACTTGGA
ATCATCGAAGCACATGTACAAGTTCATGGGCCTAAATCTGCTATATATGT
TGGCCACGAATCGCCTTGCCGACTTCCACATCGAACTGGAACGTTTACCG
ACGGCTTTGCTGCTCCATGATAGCTTCATCCAACCCGTTTTGGCTTTGGA
GAACTACTACATGGAGGGCAGATACAACAAGATACTGCAAGCCAAGAAAT
CTATGCCCTCGGAGATCTATTCGAATTTTATGGACATCCTGGTGAACACG
GCGCGTGAGGAGATCGCATCCTGCATGGAGAAATCCTATCTGAAGATGGC
GCCCAAACTAGCTGCTCAGCGTTTGGGCCTTCGTCCCGGTTCCAAGGAGC
TTTTCGAGCTGGCGACTAAGCGCCAGTGGTGTCTGGACGAGGAGGGGAAC
TACGACTATGCTGGACTTCATACCAGACCCATGGAGAAGGTCCCTGCCAA
GGACATCGCCACGCATAATCTCACTTATGCCCAAGAGCTGGAGAAAATAG
TTTGAATTTTCTCATTAGATCAATTCTTGCTTCTAATCCCCTCAACCGGA
AAATAATATCCAGAATTTATACATTCGTCCAAAAATCAGTAAAAAAAAAA
AAAAAAAAA

AT18239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12R-RA 945 Rpn12R-RA 1..943 1..943 4535 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15031679..15032618 940..1 4610 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15041628..15042570 943..1 4535 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15034728..15035670 943..1 4535 98.7 Minus
Blast to na_te.dros performed on 2019-03-16 16:47:09 has no hits.

AT18239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:48:19 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15031679..15032618 1..940 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:11:58 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11552-RA 1..789 67..855 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:38 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..789 67..855 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:45:49 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..789 67..855 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:22 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11552-RA 1..789 67..855 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:41:29 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..789 67..855 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:19 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11552-RA 1..940 1..940 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:38 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..940 1..940 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:45:49 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..940 1..940 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:22 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11552-RA 1..940 1..940 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:41:29 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn12R-RA 1..940 1..940 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:19 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15041631..15042570 1..940 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:19 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15041631..15042570 1..940 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:19 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15041631..15042570 1..940 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:45:49 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15034731..15035670 1..940 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:20 Download gff for AT18239.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15034731..15035670 1..940 98   Minus

AT18239.hyp Sequence

Translation from 1 to 854

> AT18239.hyp
VNQNEQNFHSQKFSRCRDFAVIMSNLYTELKNEWSKHAPNLTHCSRLLDG
FKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVEHSITIKDYAAFER
YMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLP
TALLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNT
AREEIASCMEKSYLKMAPKLAAQRLGLRPGSKELFELATKRQWCLDEEGN
YDYAGLHTRPMEKVPAKDIATHNLTYAQELEKIV*

AT18239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12R-PA 262 CG11552-PA 1..262 23..284 1357 100 Plus
Rpn12-PA 264 CG4157-PA 4..264 23..284 660 49.6 Plus

AT18239.pep Sequence

Translation from 66 to 854

> AT18239.pep
MSNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQK
DQLIKSREMLEIAVEHSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHM
YKFMGLNLLYMLATNRLADFHIELERLPTALLLHDSFIQPVLALENYYME
GRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMAPKLAA
QRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPMEKVPAKDIATH
NLTYAQELEKIV*

AT18239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10751-PA 262 GF10751-PA 1..262 1..262 1194 84 Plus
Dana\GF23919-PA 264 GF23919-PA 4..264 1..262 616 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13696-PA 262 GG13696-PA 1..262 1..262 1281 95 Plus
Dere\GG13563-PA 264 GG13563-PA 7..264 4..262 598 49.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16677-PA 264 GH16677-PA 7..264 7..262 905 65.9 Plus
Dgri\GH15898-PA 264 GH15898-PA 4..264 1..262 589 48.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn12R-PA 262 CG11552-PA 1..262 1..262 1357 100 Plus
Rpn12-PA 264 CG4157-PA 4..264 1..262 660 49.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11363-PA 264 GI11363-PA 1..264 1..262 986 69.3 Plus
Dmoj\GI16550-PA 264 GI16550-PA 4..264 1..262 601 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22312-PA 263 GL22312-PA 1..263 1..262 999 70.7 Plus
Dper\GL21520-PA 789 GL21520-PA 1..193 1..194 663 66.8 Plus
Dper\GL17868-PA 264 GL17868-PA 4..264 1..262 606 49.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26312-PA 263 GA26312-PA 1..263 1..262 1005 71.1 Plus
Dpse\GA27448-PA 263 GA27448-PA 1..263 1..262 999 70.3 Plus
Dpse\GA17993-PA 264 GA17993-PA 4..264 1..262 606 49.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24516-PA 262 GM24516-PA 1..262 1..262 1364 97.3 Plus
Dsec\GM25643-PA 264 GM25643-PA 4..264 1..262 603 49.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12587-PA 262 GD12587-PA 1..262 1..262 1364 97.3 Plus
Dsim\GD14646-PA 264 GD14646-PA 4..264 1..262 603 49.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11618-PA 264 GJ11618-PA 1..264 1..262 931 67.8 Plus
Dvir\GJ12802-PA 264 GJ12802-PA 7..264 4..262 599 49.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17411-PA 262 GK17411-PA 1..262 1..262 1012 71 Plus
Dwil\GK20064-PA 264 GK20064-PA 4..264 1..262 604 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19991-PA 262 GE19991-PA 1..262 1..262 1344 95.8 Plus
Dyak\GE19861-PA 264 GE19861-PA 7..264 4..262 598 49.4 Plus