AT18358.complete Sequence
622 bp (622 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070800
> AT18358.complete
GTGTGTACTGCCTATGACAGCCATTTATTCTAAACAGAATCACAAAATTT
TTTAGTTCGAACCACTTAGTGTACAATGAGTTGGCTGTCAACCATTTTCG
GTATTATTTTGATAACACTTTTGTGTACGATATGGATAGCAGCGCATCCG
CGATGGGAGCAAATGGCCAAAGCTGTGGCCTCCAAGATGAACTACGACGA
CCAGCATAGAATCCACACCGCATCTAGGGCAGCCAAAAACGTGGATGCGC
AGATCCACGATTTCTACGTCAAGCTGGAGAATCAGAAGAAGGTTGCTGCC
CGTGAAGTATTGGATAGTGCATACACTGAAACGACCAAATGCATCGAGGT
ATTCTACAGTGGTGAGCTGGAGCAAACGTTTAAGGACTGCATCGAGCACG
TCACCCGTCTGCACATGGAAAGGCTGAGGTCACTCCTCCAAATTACCACT
AAGCGACAGGCGAGCGGAGCAAGCAGACTTAAAATCTGGCACTGATAATA
CCCTGGAGTCTTCCCAGGATCGCTGGCAGGCAACGAGTCTGTTTTCTTTG
CACCCAGTGCTTTCTGATGTACTTTAATTAGACAGTCAACTCGAGACCCG
TCAAAAAAAAAAAAAAAAAAAA
AT18358.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:38:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14294-RA | 603 | CG14294-RA | 1..603 | 1..603 | 3015 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:44:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 14725650..14726251 | 602..1 | 3010 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:44:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18901662..18902264 | 603..1 | 3015 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 18642493..18643095 | 603..1 | 3015 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 08:44:13 has no hits.
AT18358.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:45:19 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 14725650..14726251 | 1..602 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:12:10 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..420 | 76..495 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:52 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..420 | 76..495 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:24 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..420 | 76..495 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:23 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..420 | 76..495 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:20 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..420 | 76..495 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:21 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..602 | 1..602 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:52 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..602 | 1..602 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:24 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..602 | 1..602 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:23 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..602 | 1..602 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:20 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14294-RA | 1..602 | 1..602 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18901663..18902264 | 1..602 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18901663..18902264 | 1..602 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18901663..18902264 | 1..602 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:24 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14727385..14727986 | 1..602 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:07 Download gff for
AT18358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18642494..18643095 | 1..602 | 100 | | Minus |
AT18358.pep Sequence
Translation from 75 to 494
> AT18358.pep
MSWLSTIFGIILITLLCTIWIAAHPRWEQMAKAVASKMNYDDQHRIHTAS
RAAKNVDAQIHDFYVKLENQKKVAAREVLDSAYTETTKCIEVFYSGELEQ
TFKDCIEHVTRLHMERLRSLLQITTKRQASGASRLKIWH*
AT18358.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:19:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19986-PA | 140 | GF19986-PA | 1..140 | 1..139 | 253 | 37.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:19:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16302-PA | 141 | GG16302-PA | 1..140 | 1..139 | 471 | 66.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14294-PA | 139 | CG14294-PA | 1..139 | 1..139 | 724 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:19:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18677-PA | 139 | GM18677-PA | 1..139 | 1..139 | 658 | 86.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:19:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20148-PA | 139 | GD20148-PA | 1..139 | 1..139 | 610 | 87.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:19:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25166-PA | 111 | GE25166-PA | 1..111 | 30..139 | 420 | 73 | Plus |
AT18358.hyp Sequence
Translation from 75 to 494
> AT18358.hyp
MSWLSTIFGIILITLLCTIWIAAHPRWEQMAKAVASKMNYDDQHRIHTAS
RAAKNVDAQIHDFYVKLENQKKVAAREVLDSAYTETTKCIEVFYSGELEQ
TFKDCIEHVTRLHMERLRSLLQITTKRQASGASRLKIWH*
AT18358.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:03:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14294-PA | 139 | CG14294-PA | 1..139 | 1..139 | 724 | 100 | Plus |