Clone AT18358 Report

Search the DGRC for AT18358

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:183
Well:58
Vector:pOTB7
Associated Gene/TranscriptCG14294-RA
Protein status:AT18358.pep: gold
Preliminary Size:333
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14294 2001-12-16 Blastp of sequenced clone
CG14294 2002-01-01 Sim4 clustering to Release 2
CG14294 2003-01-01 Sim4 clustering to Release 3
CG14294 2008-04-29 Release 5.5 accounting
CG14294 2008-08-15 Release 5.9 accounting
CG14294 2008-12-18 5.12 accounting

Clone Sequence Records

AT18358.complete Sequence

622 bp (622 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070800

> AT18358.complete
GTGTGTACTGCCTATGACAGCCATTTATTCTAAACAGAATCACAAAATTT
TTTAGTTCGAACCACTTAGTGTACAATGAGTTGGCTGTCAACCATTTTCG
GTATTATTTTGATAACACTTTTGTGTACGATATGGATAGCAGCGCATCCG
CGATGGGAGCAAATGGCCAAAGCTGTGGCCTCCAAGATGAACTACGACGA
CCAGCATAGAATCCACACCGCATCTAGGGCAGCCAAAAACGTGGATGCGC
AGATCCACGATTTCTACGTCAAGCTGGAGAATCAGAAGAAGGTTGCTGCC
CGTGAAGTATTGGATAGTGCATACACTGAAACGACCAAATGCATCGAGGT
ATTCTACAGTGGTGAGCTGGAGCAAACGTTTAAGGACTGCATCGAGCACG
TCACCCGTCTGCACATGGAAAGGCTGAGGTCACTCCTCCAAATTACCACT
AAGCGACAGGCGAGCGGAGCAAGCAGACTTAAAATCTGGCACTGATAATA
CCCTGGAGTCTTCCCAGGATCGCTGGCAGGCAACGAGTCTGTTTTCTTTG
CACCCAGTGCTTTCTGATGTACTTTAATTAGACAGTCAACTCGAGACCCG
TCAAAAAAAAAAAAAAAAAAAA

AT18358.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14294-RA 603 CG14294-RA 1..603 1..603 3015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14725650..14726251 602..1 3010 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18901662..18902264 603..1 3015 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18642493..18643095 603..1 3015 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:44:13 has no hits.

AT18358.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:45:19 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14725650..14726251 1..602 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:12:10 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..420 76..495 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:52 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..420 76..495 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:24 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..420 76..495 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:23 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..420 76..495 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:20 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..420 76..495 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:21 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:52 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:24 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:23 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:20 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
CG14294-RA 1..602 1..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18901663..18902264 1..602 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18901663..18902264 1..602 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:19 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18901663..18902264 1..602 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:24 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14727385..14727986 1..602 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:07 Download gff for AT18358.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18642494..18643095 1..602 100   Minus

AT18358.pep Sequence

Translation from 75 to 494

> AT18358.pep
MSWLSTIFGIILITLLCTIWIAAHPRWEQMAKAVASKMNYDDQHRIHTAS
RAAKNVDAQIHDFYVKLENQKKVAAREVLDSAYTETTKCIEVFYSGELEQ
TFKDCIEHVTRLHMERLRSLLQITTKRQASGASRLKIWH*

AT18358.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19986-PA 140 GF19986-PA 1..140 1..139 253 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16302-PA 141 GG16302-PA 1..140 1..139 471 66.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14294-PA 139 CG14294-PA 1..139 1..139 724 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18677-PA 139 GM18677-PA 1..139 1..139 658 86.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20148-PA 139 GD20148-PA 1..139 1..139 610 87.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25166-PA 111 GE25166-PA 1..111 30..139 420 73 Plus

AT18358.hyp Sequence

Translation from 75 to 494

> AT18358.hyp
MSWLSTIFGIILITLLCTIWIAAHPRWEQMAKAVASKMNYDDQHRIHTAS
RAAKNVDAQIHDFYVKLENQKKVAAREVLDSAYTETTKCIEVFYSGELEQ
TFKDCIEHVTRLHMERLRSLLQITTKRQASGASRLKIWH*

AT18358.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14294-PA 139 CG14294-PA 1..139 1..139 724 100 Plus