Clone AT18465 Report

Search the DGRC for AT18465

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:184
Well:65
Vector:pOTB7
Associated Gene/TranscriptCG6629-RA
Protein status:AT18465.pep: gold
Preliminary Size:842
Sequenced Size:1001

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6629 2002-01-01 Sim4 clustering to Release 2
CG6629 2002-01-18 Blastp of sequenced clone
CG6629 2003-01-01 Sim4 clustering to Release 3
CG6629 2008-04-29 Release 5.5 accounting
CG6629 2008-08-15 Release 5.9 accounting
CG6629 2008-12-18 5.12 accounting

Clone Sequence Records

AT18465.complete Sequence

1001 bp (1001 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089360

> AT18465.complete
CAACTTGTTAAATTTTTTTTTCTATTCCTATCTAACACTGCCAATTTGTA
ACAAAACAAACTTTGTTAAAGAATTCTGAAATTTATTTGACAAAAACTCA
AATATAAAAATGAACACTTGTCGCTCATTGGCTCGAGGATTGAATATTTG
CAGTCCGCAATTAAGGCACTTGCTCGCCCAAAAACCATTCAACTCGGCTC
GTCTTCTGGCTACTAAAGCCCCAAAGGATCATAAGGCTAGTGGACCCACG
ACAATTGGACCTAGTGGCGATATCCTCGTTCCGCCTGTCACTTTGAAAGT
GATACCCTTTCGTATGCCTCCCGATTTGCCTTATGACGATCGAAATATGC
TGCTTGGAAGACAGTTATCGCCACATTTGTCCATCTACAAAATTCAATTG
ACTTCCACCTTGTCCGCATTTCTACGAATTAGTGGGTTTGTTCTGGCCGT
TTTTGTTTGGTTCGTGGGAATCAGCGGCCTTTGCTTGCAAGGCGATATGG
AGGGATTTATAAAGAAAGTCGAAAAATGTGACTGCCACGGCATGGTGACG
ATGGCCAAGGTGATGGTGACCATGCCATTTGCCTACCATACAGTCGCCGG
AACTCGACATTTGATCTGGTATTTGAACAAGTTTCTCACGATACCAGAGA
TCTATGCCACCGGCTATGTGGCTGTGGCTCTAACCATTGCTCTGTCTGCC
TTTTTGCTGGCCGTTAAAGTGGGCGAGAAGGTTAAGGAGGAGGTGGTAGA
TCTCACAAAAACCAAAAAGGGTCAAAAGGCTAAAAAAGAGGCTCCGAAGG
ATGCGAAGAAAGATGCTCCCAAGGATACCAAAAAGGAACCCAAGAAGGAT
GCAAAGGACAAGAAGAAAGACGAGGAAGGCAAGTCTGCCAAATGATCAAA
TACTATTCTGTTTTGTGTGTTTTATTAGATGACTGTGTAAAGTTTTTTAA
GACGTGCTATCCAAATCTAAACGTATTAAGTCTAAAAAAAAAAAAAAAAA
A

AT18465.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6629-RA 1042 CG6629-RA 34..1021 1..988 4925 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6940206..6941069 983..120 4320 100 Minus
chr3R 27901430 chr3R 6941122..6941241 120..1 600 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:52:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11114666..11115534 988..120 4330 99.9 Minus
3R 32079331 3R 11115587..11115706 120..1 600 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10855497..10856365 988..120 4330 99.8 Minus
3R 31820162 3R 10856418..10856537 120..1 600 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:59:41 has no hits.

AT18465.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:00:29 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6940206..6941068 121..983 100 <- Minus
chr3R 6941122..6941241 1..120 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:12:22 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..786 110..895 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:47:22 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..786 110..895 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:23 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..786 110..895 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:15 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..786 110..895 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:07:47 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..786 110..895 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:11:32 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..983 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:47:21 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..983 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:23 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..983 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:15 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..983 1..983 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:07:47 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6629-RA 1..983 1..983 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:29 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11114671..11115533 121..983 100 <- Minus
3R 11115587..11115706 1..120 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:29 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11114671..11115533 121..983 100 <- Minus
3R 11115587..11115706 1..120 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:29 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11114671..11115533 121..983 100 <- Minus
3R 11115587..11115706 1..120 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:23 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6940393..6941255 121..983 100 <- Minus
arm_3R 6941309..6941428 1..120 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:01 Download gff for AT18465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10855502..10856364 121..983 100 <- Minus
3R 10856418..10856537 1..120 100   Minus

AT18465.pep Sequence

Translation from 109 to 894

> AT18465.pep
MNTCRSLARGLNICSPQLRHLLAQKPFNSARLLATKAPKDHKASGPTTIG
PSGDILVPPVTLKVIPFRMPPDLPYDDRNMLLGRQLSPHLSIYKIQLTST
LSAFLRISGFVLAVFVWFVGISGLCLQGDMEGFIKKVEKCDCHGMVTMAK
VMVTMPFAYHTVAGTRHLIWYLNKFLTIPEIYATGYVAVALTIALSAFLL
AVKVGEKVKEEVVDLTKTKKGQKAKKEAPKDAKKDAPKDTKKEPKKDAKD
KKKDEEGKSAK*

AT18465.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18264-PA 281 GF18264-PA 1..244 1..224 661 55.1 Plus
Dana\GF18258-PA 152 GF18258-PA 8..149 60..199 250 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17249-PA 269 GG17249-PA 1..216 1..216 1032 88.4 Plus
Dere\GG17240-PA 152 GG17240-PA 7..149 59..199 230 41.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19425-PA 170 GH19425-PA 7..169 72..235 347 44.3 Plus
Dgri\GH19420-PA 171 GH19420-PA 27..168 60..199 266 40.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG6629-PA 261 CG6629-PA 1..261 1..261 1350 100 Plus
SdhC-PB 171 CG6666-PB 26..168 59..199 265 41.3 Plus
SdhC-PA 171 CG6666-PA 26..168 59..199 265 41.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22631-PA 229 GI22631-PA 43..163 73..192 350 53.7 Plus
Dmoj\GI22625-PA 152 GI22625-PA 8..149 60..199 276 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12050-PA 307 GL12050-PA 90..252 58..219 443 52.8 Plus
Dper\GL12041-PA 152 GL12041-PA 21..149 72..199 266 43.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27966-PA 235 GA27966-PA 18..180 58..219 448 53.4 Plus
Dpse\GA26173-PA 332 GA26173-PA 115..277 58..219 444 52.8 Plus
Dpse\GA19764-PB 171 GA19764-PB 40..168 72..199 267 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26134-PA 264 GM26134-PA 1..216 1..216 1112 96.3 Plus
Dsec\GM26120-PA 171 GM26120-PA 26..168 59..199 231 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20687-PA 262 GD20687-PA 1..213 1..216 1090 95.4 Plus
Dsim\GD20679-PA 152 GD20679-PA 7..149 59..199 231 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23876-PA 269 GJ23876-PA 70..227 50..210 418 50.6 Plus
Dvir\GJ23871-PA 170 GJ23871-PA 26..167 60..199 275 41.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13994-PA 230 GK13994-PA 5..171 59..227 403 48.2 Plus
Dwil\GK13274-PA 174 GK13274-PA 30..171 60..199 255 39.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24651-PA 265 GE24651-PA 1..227 1..227 1054 86.3 Plus
Dyak\GE24640-PA 171 GE24640-PA 26..168 59..199 230 41.3 Plus

AT18465.hyp Sequence

Translation from 109 to 894

> AT18465.hyp
MNTCRSLARGLNICSPQLRHLLAQKPFNSARLLATKAPKDHKASGPTTIG
PSGDILVPPVTLKVIPFRMPPDLPYDDRNMLLGRQLSPHLSIYKIQLTST
LSAFLRISGFVLAVFVWFVGISGLCLQGDMEGFIKKVEKCDCHGMVTMAK
VMVTMPFAYHTVAGTRHLIWYLNKFLTIPEIYATGYVAVALTIALSAFLL
AVKVGEKVKEEVVDLTKTKKGQKAKKEAPKDAKKDAPKDTKKEPKKDAKD
KKKDEEGKSAK*

AT18465.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6629-PA 261 CG6629-PA 1..261 1..261 1350 100 Plus
SdhC-PB 171 CG6666-PB 26..168 59..199 265 41.3 Plus
SdhC-PA 171 CG6666-PA 26..168 59..199 265 41.3 Plus