Clone AT18611 Report

Search the DGRC for AT18611

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:186
Well:11
Vector:pOTB7
Associated Gene/TranscriptCG30148-RA
Protein status:AT18611.pep: gold
Preliminary Size:702
Sequenced Size:655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13429 2002-01-01 Sim4 clustering to Release 2
CG30148 2002-04-21 Blastp of sequenced clone
CG30148 2003-01-01 Sim4 clustering to Release 3
CG30148 2008-04-29 Release 5.5 accounting
CG30148 2008-08-15 Release 5.9 accounting
CG30148 2008-12-18 5.12 accounting

Clone Sequence Records

AT18611.complete Sequence

655 bp (655 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113284

> AT18611.complete
GTTTGAAGGCAGGTCCGCTCATCGAGTTTAGTTCTGTTCGGAGGTCCGAT
ACCGCAACACGTTCCATTTCGATTCGTGATGCCTACACTTCCGCTGTGCC
TGCTGCTCCTGGTGTTGGCGATTGCCTTTGGCCACGCCTACGAGGCACCT
GAGGCACAGGTGCGCGTGTTCTATCCCCGGGGATTCGAGGTCTCCATTCC
GGATGCGGAGGGTATTTCACTGTTTGCCTTCCATGGCAAGCTAAACGAGG
AGTTCGACGGCCTGGAGGCGGGACAATGGTCCAGGGATATTCCGAAAGCC
AAGCGGGGACGTTGGACATTCCGAGATCACAAGACAAAGCTCAACCATGG
AGATACCCTGTACTTTTGGACCTACGTCATTTACAACGGGCTGGGCTATA
GACAGGATGAAGGTGCTCATGTGGTCACCAGTTACGACAATCCACATAAA
TAGTGTCATCTTTCAATTATGGGATCGTGGACGAGCTTAAAGCTCATCTT
GAACCTTTGTTTATGGAGCGTACTTTCCATGCTCATCCGCTCTTTTGGCT
CACAGCTAATCTTTTTGCTTGCTACACAAAGAACAATGCGTTCACAAATA
ATAATAATAATTCACCAAATTAAAGTGTTATCAAAACAAAAAAAAAAAAA
AAAAA

AT18611.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG30148-RA 652 CG30148-RA 1..642 1..638 3020 98.2 Plus
GNBP3-RA 1531 GNBP3-RA 111..211 169..269 280 85.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16433803..16434439 637..1 3185 100 Minus
chr3L 24539361 chr3L 8947173..8947403 169..399 315 75.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20547040..20547681 638..1 3010 98.3 Minus
3L 28110227 3L 8955131..8955361 169..399 315 75.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20548239..20548880 638..1 3020 98.2 Minus
3L 28103327 3L 8948231..8948331 169..269 280 85.1 Plus
Blast to na_te.dros performed on 2019-03-16 15:47:44 has no hits.

AT18611.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:48:53 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16433803..16434439 1..637 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:12:44 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..375 79..453 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:01:09 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..375 79..453 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:20 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..375 79..453 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:54:30 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..375 79..453 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:54:07 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..375 79..453 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:42:26 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..641 1..637 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:01:08 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..641 1..637 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:20 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..618 24..637 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:54:30 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..641 1..637 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:54:07 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
CG30148-RA 1..618 24..637 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:53 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547041..20547681 1..637 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:53 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547041..20547681 1..637 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:53 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20547041..20547681 1..637 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:20 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16434546..16435186 1..637 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:26:41 Download gff for AT18611.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20548240..20548880 1..637 98   Minus

AT18611.hyp Sequence

Translation from 78 to 452

> AT18611.hyp
MPTLPLCLLLLVLAIAFGHAYEAPEAQVRVFYPRGFEVSIPDAEGISLFA
FHGKLNEEFDGLEAGQWSRDIPKAKRGRWTFRDHKTKLNHGDTLYFWTYV
IYNGLGYRQDEGAHVVTSYDNPHK*

AT18611.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG30148-PB 124 CG30148-PB 1..124 1..124 679 100 Plus
CG30148-PA 124 CG30148-PA 1..124 1..124 679 100 Plus
GNBP3-PA 490 CG5008-PA 13..132 7..123 425 66.1 Plus
GNBP-like3-PA 152 CG13422-PA 7..124 4..121 284 44.1 Plus
CG12780-PA 100 CG12780-PA 4..93 21..109 214 50 Plus

AT18611.pep Sequence

Translation from 78 to 452

> AT18611.pep
MPTLPLCLLLLVLAIAFGHAYEAPEAQVRVFYPRGFEVSIPDAEGISLFA
FHGKLNEEFDGLEAGQWSRDIPKAKRGRWTFRDHKTKLNHGDTLYFWTYV
IYNGLGYRQDEGAHVVTSYDNPHK*

AT18611.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12664-PA 123 GF12664-PA 1..121 1..121 530 80.2 Plus
Dana\GF24364-PA 492 GF24364-PA 4..124 1..119 408 63.4 Plus
Dana\GF12269-PA 148 GF12269-PA 7..120 8..121 260 44.7 Plus
Dana\GF19806-PA 102 GF19806-PA 4..90 21..107 196 42.5 Plus
Dana\GF23634-PA 492 GF23634-PA 1..109 1..112 162 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20857-PA 123 GG20857-PA 13..122 12..121 533 88.2 Plus
Dere\GG14358-PA 486 GG14358-PA 12..120 6..119 430 70.2 Plus
Dere\GG22037-PA 152 GG22037-PA 4..124 1..121 294 45.5 Plus
Dere\GG10636-PA 100 GG10636-PA 3..91 20..107 204 47.2 Plus
Dere\GG13669-PA 492 GG13669-PA 4..107 6..108 149 36.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21065-PA 122 GH21065-PA 5..120 6..121 423 66.4 Plus
Dgri\GH15336-PA 484 GH15336-PA 8..121 4..121 384 61.9 Plus
Dgri\GH20840-PA 223 GH20840-PA 11..125 6..120 317 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30148-PB 124 CG30148-PB 1..124 1..124 679 100 Plus
CG30148-PA 124 CG30148-PA 1..124 1..124 679 100 Plus
GNBP3-PA 490 CG5008-PA 13..132 7..123 425 66.1 Plus
GNBP-like3-PA 152 CG13422-PA 7..124 4..121 284 44.1 Plus
CG12780-PA 100 CG12780-PA 4..93 21..109 214 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18667-PA 124 GI18667-PA 3..118 4..119 470 74.1 Plus
Dmoj\GI12940-PA 487 GI12940-PA 9..119 8..120 405 66.4 Plus
Dmoj\GI20944-PA 159 GI20944-PA 11..113 6..107 285 54.4 Plus
Dmoj\GI20945-PA 125 GI20945-PA 11..113 6..107 269 51.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16809-PA 124 GL16809-PA 1..121 1..121 500 76 Plus
Dper\GL20727-PA 449 GL20727-PA 12..124 6..119 409 65.8 Plus
Dper\GL17665-PA 155 GL17665-PA 23..119 20..116 257 49.5 Plus
Dper\GL10856-PA 101 GL10856-PA 3..93 20..109 222 46.2 Plus
Dper\GL22887-PA 499 GL22887-PA 10..101 8..100 154 38.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15677-PA 124 GA15677-PA 1..121 1..121 507 76 Plus
Dpse\GA18590-PA 496 GA18590-PA 12..124 6..119 408 65.8 Plus
Dpse\GA12275-PA 155 GA12275-PA 23..119 20..116 272 52.6 Plus
Dpse\GA11807-PA 101 GA11807-PA 3..93 20..109 218 45.1 Plus
Dpse\GA19936-PA 499 GA19936-PA 10..101 8..100 151 37.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19784-PA 124 GM19784-PA 12..123 12..123 551 90.2 Plus
Dsec\GM25102-PA 490 GM25102-PA 24..124 19..119 408 71.3 Plus
Dsec\GM22021-PA 152 GM22021-PA 7..123 4..120 303 47 Plus
Dsec\GM20681-PA 100 GM20681-PA 3..98 20..113 213 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25276-PA 124 GD25276-PA 12..123 12..123 559 91.1 Plus
Dsim\GD14138-PA 490 GD14138-PA 12..124 6..119 419 66.7 Plus
Dsim\GD11519-PA 152 GD11519-PA 7..123 4..120 307 47.9 Plus
Dsim\GD10160-PA 100 GD10160-PA 3..98 20..113 215 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21683-PA 124 GJ21683-PA 3..123 4..124 453 66.9 Plus
Dvir\GJ13082-PA 491 GJ13082-PA 22..121 20..119 383 67 Plus
Dvir\GJ20666-PA 160 GJ20666-PA 11..127 4..120 288 47 Plus
Dvir\GJ11226-PA 500 GJ11226-PA 13..114 6..108 151 35.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19325-PA 122 GK19325-PA 5..122 4..122 462 72.3 Plus
Dwil\GK16747-PA 497 GK16747-PA 6..121 6..121 394 61.2 Plus
Dwil\GK20991-PA 116 GK20991-PA 5..114 4..115 366 60.7 Plus
Dwil\GK20992-PA 115 GK20992-PA 5..114 4..115 360 59.8 Plus
Dwil\GK19147-PA 100 GK19147-PA 4..99 20..115 337 62.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13797-PA 124 GE13797-PA 14..124 14..124 559 91.9 Plus
Dyak\GE20789-PA 490 GE20789-PA 24..124 19..119 401 71.3 Plus
Dyak\GE12117-PA 152 GE12117-PA 7..123 4..120 302 47 Plus
Dyak\GE22957-PA 100 GE22957-PA 3..91 20..107 213 49.4 Plus