Clone AT18730 Report

Search the DGRC for AT18730

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:187
Well:30
Vector:pOTB7
Associated Gene/TranscriptCG11698-RA
Protein status:AT18730.pep: gold
Preliminary Size:768
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11698 2002-01-01 Sim4 clustering to Release 2
CG11698 2002-05-18 Blastp of sequenced clone
CG11698 2003-01-01 Sim4 clustering to Release 3
CG11698 2008-04-29 Release 5.5 accounting
CG11698 2008-08-15 Release 5.9 accounting
CG11698 2008-12-18 5.12 accounting

Clone Sequence Records

AT18730.complete Sequence

963 bp (963 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118696

> AT18730.complete
CCTCGTGCCGTGAGCCTTGAGATTTATGTACGATGCAAGATTCCCAATGC
GTTGCGACTCCCTGGTTACGATGTTGCTTCTTTCGAACATCCTGCTGTCG
ACCGCCGCGCATCCTGCCCAGCGGAATGATCCGCGTTTCAAGCCCGGCTC
CCTTCCCTGCAAGACGAGCATGAAAGCCAGCCAGGTGGCCTCGAAGGCGG
CCAAGGATGCGAAGGACGCCAAGGATGCGCAGCCATGTGCCGCGGAGATG
GCGGGCTACAGGGCACGGGAAATGCTGGCGGACAGGGCGTTGCAGGCGGC
CAAGGCTGCGGAGGCGGCTCTCAACGGGAAGAAGCAGCTCCTCGATGAAT
ACACCAAAAGTCTGGCAGAAACGAACAGGGTTATCGAGGAAATCCAACGA
GCCATTGCTGCCAGCTCGTGCTCGGCGACGTCGGCAAAGGGGATCCGTGA
CAAGCTCTGCACATCCGTGAACATTATGAAGAGTATGCTAAAGGAAATGG
GCGGAAATCTCGATAACATCCGGAGGATGGCCGACAGTGCCCAGAAAGAG
GCCCTGGAAAAGCGCAGCCTTCTGAAAGCGGCCAGGATGCGGGTGGAAGA
GCTCCATAGCTGCATGTGCGAGGCTCAGAAGGATCTGGAGCGAAATAAGC
AGAGCGCTAAGAAGGCCAACGACGCCGCCAAGGAAGCACAGCAACGGATC
GAAGCCTTGCAAAAACTGGTGAGCAGGATTAAGATGCTGAAGCGAAAGGA
TCTTCAGTCGCTCGAGAACTTCCTGCGCAGGAGAAGAAGTAGCACTCCGG
AAAAAACAAGTTGAGTTTCTTGTTTGTTATGGCAATAATCATATTTATAT
TTTATAAAATACAATAAATAAGAACATATAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

AT18730.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11698-RA 875 CG11698-RA 7..875 11..879 4330 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4138244..4139112 11..879 4345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8312229..8313098 11..880 4335 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8053060..8053929 11..880 4335 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 21:23:48 has no hits.

AT18730.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:24:52 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4138238..4139067 3..834 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:12:53 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 1..789 26..814 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:47:01 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 1..789 26..814 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:46:47 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 1..789 26..814 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:22 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 1..789 26..814 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:10 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 1..789 26..814 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:51 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 2..875 8..879 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:47:00 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 2..875 8..879 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:46:47 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 36..910 3..879 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:22 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 2..875 8..879 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:10 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG11698-RA 36..910 3..879 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:24:52 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8312223..8313097 3..879 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:24:52 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8312223..8313097 3..879 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:24:52 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8312223..8313097 3..879 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:46:47 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4137945..4138819 3..879 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:43 Download gff for AT18730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8053054..8053928 3..879 99   Plus

AT18730.hyp Sequence

Translation from 25 to 813

> AT18730.hyp
MYDARFPMRCDSLVTMLLLSNILLSTAAHPAQRNDPRFKPGSLPCKTSMK
ASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALN
GKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSVNI
MKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEA
QKDLERNKQSAKKANDAAKEAQQRIEALQKLVSRIKMLKRKDLQSLENFL
RRRRSSTPEKTS*

AT18730.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11698-PA 262 CG11698-PA 1..262 1..262 1291 100 Plus
CG14840-PA 300 CG14840-PA 87..271 50..234 320 38.4 Plus
CG14841-PA 274 CG14841-PA 85..268 50..233 300 37.5 Plus
CG11694-PA 261 CG11694-PA 50..239 41..224 278 36.8 Plus
CG34459-PC 305 CG34459-PC 114..294 44..224 263 37 Plus

AT18730.pep Sequence

Translation from 25 to 813

> AT18730.pep
MYDARFPMRCDSLVTMLLLSNILLSTAAHPAQRNDPRFKPGSLPCKTSMK
ASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALN
GKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSVNI
MKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEA
QKDLERNKQSAKKANDAAKEAQQRIEALQKLVSRIKMLKRKDLQSLENFL
RRRRSSTPEKTS*

AT18730.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18340-PA 258 GF18340-PA 1..255 8..261 508 55.5 Plus
Dana\GF11413-PA 470 GF11413-PA 151..291 84..224 155 36.9 Plus
Dana\GF23179-PA 289 GF23179-PA 133..275 98..240 146 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24806-PA 255 GG24806-PA 1..255 8..262 832 77.6 Plus
Dere\GG20633-PA 462 GG20633-PA 105..285 44..224 182 38.6 Plus
Dere\GG24365-PA 218 GG24365-PA 35..82 214..261 179 75 Plus
Dere\GG21383-PA 244 GG21383-PA 14..243 29..243 164 33.9 Plus
Dere\GG21391-PA 298 GG21391-PA 133..269 98..234 150 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14184-PA 243 GH14184-PA 17..243 29..253 301 38.3 Plus
Dgri\GH19676-PA 252 GH19676-PA 58..225 40..205 152 36.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG11698-PA 262 CG11698-PA 1..262 1..262 1291 100 Plus
CG14840-PA 300 CG14840-PA 87..271 50..234 320 38.4 Plus
CG14841-PA 274 CG14841-PA 85..268 50..233 300 37.5 Plus
CG11694-PA 261 CG11694-PA 50..239 41..224 278 36.8 Plus
CG34459-PC 305 CG34459-PC 114..294 44..224 263 37 Plus
CG34459-PB 305 CG34459-PB 114..294 44..224 263 37 Plus
CG34459-PA 305 CG34459-PA 114..294 44..224 263 37 Plus
CG12985-PA 370 CG12985-PA 120..296 49..225 238 28.2 Plus
CG14354-PA 298 CG14354-PA 65..238 51..224 237 33.3 Plus
CG14839-PA 282 CG14839-PA 82..258 50..226 201 34.3 Plus
CG33257-PA 330 CG33257-PA 97..265 54..222 155 25.4 Plus
CG11693-PA 318 CG11693-PA 112..279 54..221 151 26.2 Plus
CG11693-PB 323 CG11693-PB 117..284 54..221 151 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24867-PA 240 GI24867-PA 2..210 21..226 244 39.6 Plus
Dmoj\GI20828-PA 301 GI20828-PA 98..279 43..224 208 34.6 Plus
Dmoj\GI24535-PA 266 GI24535-PA 65..254 50..239 158 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23428-PA 258 GL23428-PA 1..249 8..255 438 46.2 Plus
Dper\GL17739-PA 409 GL17739-PA 113..295 38..224 152 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11149-PA 250 GA11149-PA 1..244 8..246 399 45.1 Plus
Dpse\GA11146-PB 267 GA11146-PB 60..245 45..224 154 37.6 Plus
Dpse\GA27677-PA 402 GA27677-PA 109..291 38..224 146 33.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23721-PA 262 GM23721-PA 1..262 1..262 996 87.8 Plus
Dsec\GM21727-PA 455 GM21727-PA 98..278 44..224 169 35.9 Plus
Dsec\GM25863-PA 265 GM25863-PA 85..264 50..229 168 38.3 Plus
Dsec\GM25864-PA 302 GM25864-PA 135..271 98..234 146 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18535-PA 214 GD18535-PA 1..214 49..262 744 86.9 Plus
Dsim\GD11222-PA 470 GD11222-PA 113..293 44..224 172 35.9 Plus
Dsim\GD20434-PA 264 GD20434-PA 84..263 50..229 167 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24511-PA 256 GJ24511-PA 1..232 8..232 331 38.5 Plus
Dvir\GJ20562-PA 352 GJ20562-PA 65..247 38..224 211 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18944-PA 251 GK18944-PA 39..249 30..255 249 32.7 Plus
Dwil\GK22021-PA 418 GK22021-PA 103..295 30..224 161 33.5 Plus
Dwil\GK14387-PA 246 GK14387-PA 1..230 8..224 154 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25865-PA 256 GE25865-PA 1..243 8..250 878 81.1 Plus
Dyak\GE11823-PA 449 GE11823-PA 101..281 44..224 178 37.5 Plus
Dyak\GE10039-PA 278 GE10039-PA 84..277 50..243 161 35.1 Plus
Dyak\GE10040-PA 301 GE10040-PA 136..272 98..234 148 34.3 Plus